KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I2082Help
Entry
LEPBI_I2082       CDS       T00693                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase (TIM; Triose-phosphate isomerase)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00010  Glycolysis / Gluconeogenesis
lbi00051  Fructose and mannose metabolism
lbi00562  Inositol phosphate metabolism
lbi01100  Metabolic pathways
lbi01110  Biosynthesis of secondary metabolites
lbi01120  Microbial metabolism in diverse environments
lbi01130  Biosynthesis of antibiotics
lbi01200  Carbon metabolism
lbi01230  Biosynthesis of amino acids
Module
lbi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lbi_M00002  Glycolysis, core module involving three-carbon compounds
lbi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEPBI_I2082 (tpiA)
   00051 Fructose and mannose metabolism
    LEPBI_I2082 (tpiA)
   00562 Inositol phosphate metabolism
    LEPBI_I2082 (tpiA)
Enzymes [BR:lbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LEPBI_I2082 (tpiA)
Exosome [BR:lbi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LEPBI_I2082 (tpiA)
  Exosomal proteins of bladder cancer cells
   LEPBI_I2082 (tpiA)
  Exosomal proteins of melanoma cells
   LEPBI_I2082 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABZ98184
UniProt: B0SSU4
Position
I:2177053..2177802
Genome map
AA seq 249 aa AA seqDB search
MRKKIIAGNWKMNLTLAEAKEITKGLLSACDSSSYEIMVFPSALHLESVASIARDSQLIV
GAQNAYQSGLTAMTGEISPVQLAELGIQTVLVGHSERRQFLGETSEFDNTKISYFLKHGL
RVVYCVGETWAEREKGNTFSVLEDQIGKGLKGITSDLFKNLVIAYEPVWAIGTGKVATPV
EAEEAHAFIRKEIGKLFVGADLVAENIQILYGGSVKPDNIKELLAKPNIDGGLVGGASQK
LDLFLGLLK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaagatcatcgcagggaattggaaaatgaacctcacgctagcggaggcaaaa
gaaatcaccaaaggtttactctcggcttgtgactcttcttcttatgaaatcatggtcttc
ccgagtgccctccatttggagtcagtggcatccattgcccgagactcccaactcatcgtg
ggggcacaaaatgcctaccaatcggggcttaccgccatgacaggtgaaatctccccagtc
cagctggcagaactgggcatccaaaccgttcttgtgggccactcggaaaggagacaattc
ctcggagaaacatccgaatttgacaataccaaaatctcctacttcttaaaacatggacta
cgagttgtctattgtgtcggggaaacttgggccgaacgagaaaaaggaaacaccttttct
gtgttagaggaccaaattggcaaaggattaaaagggatcacaagtgaccttttcaaaaac
ctcgtgattgcctatgaaccagtttgggccattggaacgggaaaagtagcaactcccgta
gaagcggaagaagcgcatgcctttatccgaaaagaaattggcaaattatttgttggtgca
gaccttgtggcggagaacattcaaattctttatggtggttcagtcaaacctgacaacatc
aaggaacttctcgccaaaccaaatattgacggtggcctcgttggtggagccagtcaaaaa
ttggatttatttttaggacttttaaaataa

DBGET integrated database retrieval system