KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I3239Help
Entry
LEPBI_I3239       CDS       T00693                                 

Gene name
sulI
Definition
(GenBank) Dihydropteroate synthase type I (DHPS; Dihydropteroate pyrophosphorylase type I)
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00790  Folate biosynthesis
lbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LEPBI_I3239 (sulI)
Enzymes [BR:lbi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LEPBI_I3239 (sulI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABZ99304
UniProt: B0SQQ7
Position
I:3353311..3354126
Genome map
AA seq 271 aa AA seqDB search
MAEIFGILNITTDSFSDGGKYINPDDAIKKGVQLLQEGADWLDVSGQSSNIAANLVTEEE
EWKRVEPVIRYFVPKGVRISLDSFRPNVQKKAIEAGVRCLNDITGFTYEGDREFLKTYGA
KHSDLKFIIMHSHNRNIAKMKSTLSPEKVIKKIQIFFRDRRNDLTAMGISESSIFFDPGM
GFFLSDDPMVSFRVLQDLEILKLEFPQLMVSVSRKSFLGNVLGNLPIEDREFATLACELH
LLKNKIPFIRTHNVLKLRHAEKIWNLCQESE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatcttcggaatcttaaacatcaccactgactcctttagtgatggaggtaag
tacataaaccccgatgacgctatcaaaaaaggagtccaactcttacaagaaggggctgat
tggttggatgtctcaggccaatcttccaatattgcggcaaacctcgtcacagaggaggaa
gaatggaaacgtgtggaacctgtcatccgttactttgttccgaaaggggttcgaatcagt
ttggatagtttccgacccaatgtacaaaagaaagcaattgaggctggggttcgttgtttg
aatgacatcactggatttacctacgaaggggatcgtgagtttttaaaaacttacggtgca
aagcactctgatctaaaattcatcatcatgcattcgcataacagaaatattgcgaaaatg
aaatcaactttgtctccagaaaaagtaatcaaaaaaatccagatcttttttagagacaga
agaaatgatctaactgcgatgggaatttcagaatcatctatcttttttgatccagggatg
ggttttttcttgagtgatgaccctatggtttcctttcgagtgcttcaagatctagaaatc
ctaaaattggaatttccacaactgatggtgagtgtctctcgaaaatcatttctcggaaat
gttttgggaaatttaccaattgaagatcgggaatttgcaactctcgcatgtgaattacat
ttattaaaaaataaaatccctttcattcggacgcataacgtccttaagctgagacatgcc
gaaaaaatttggaatttatgccaagagagtgaatga

DBGET integrated database retrieval system