KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_p0020Help
Entry
LEPBI_p0020       CDS       T00693                                 

Gene name
recB
Definition
(GenBank) Exodeoxyribonuclease V beta chain, UvrD subfamily
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    LEPBI_p0020 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lbi03400]
    LEPBI_p0020 (recB)
Enzymes [BR:lbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LEPBI_p0020 (recB)
DNA repair and recombination proteins [BR:lbi03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LEPBI_p0020 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 DUF2067
Motif
Other DBs
NCBI-ProteinID: ABZ99834
UniProt: B0SUF0
Position
p74:complement(18773..22402)
Genome map
AA seq 1209 aa AA seqDB search
MKMDHPLVNHPNFIEASAGTGKTHLIMQMLGDVMTHDVTNHTKENRLLQFLVLTFTEKAA
GELKARLKLKILELYENGKHPEYYHYLRDLDQVTISTIHGFCNMVLTEYPVETQNNPNVK
LTSNEELIRKTFYDLKRSQWEGRDKESLANDILISNLKKKEDLVISSTSKLLADTKDYVF
PEFVSLEECIHNANKSNLLGELITICEAFKGPTGEAIAAQGAKGSIPKWMENWSSLESFA
KAIRNEDTKYIAKELKRISKLSRSLGKEGKASGFDYFLLEGSTTIAKNLDAASVVLQGKI
KSVVLSLKEIFPLGQLDYDGSIFLQNTVHELTSKTKSIIENGEYLTYDQMILKVYDVIVR
NPNQILIQSLRERFQVCILDEFQDTDKNQYQIFKTLFLDKDTKSRMLFCIGDPKQSIYGF
RGADIGIYLEASRDFEGSKSTLETNYRSTKELIHGLNTIFHDETKEWGETHFFPIEEPGS
SKENYLYKKVSSPDIDTIKYKYVNPEESAIHIFDFEERFPNVNKSRNIWAETIRNEIKRI
QNKETSLLYNKKGEREIQEIKLKDIAILCGNKKETELVEFYLTKAGIPCSIYKQRGIYQS
READQIENLLECLQSSNSSQSYKKILFSDIFCIHPHEIQKFDEHSIDSYEKSLIDKWQRL
IKENRYASFFRSVMDETKLFWLEGNHTLEWERKRTNFRQIFQKLLEVQLKSNCGLLELLA
SLRELKQKKQSPEEEPLFDRETEEDSVQILTIHASKGLEWPVVFLFYFGNRGTNLTNTEY
PIEIETPEGKKRKWILDLWDLNPEKEDEENHFLNEQKRLLYVALTRPNLRLYLPKLNWGR
SKKEDSLPNSGYSQILYQELIRIQTLQNQNPFLESSFVFRNPNEFSESQTINLQTSSVTQ
TKKPSFPILYPSEIKIGRVLLQHSYTSLQANEKNLNVSQEEKKKELEETPDVEVSTTFEL
PSSAKVGNFLHKILELCDFSTFQLEVDAILESPSWKWAYQKSFLRYPLEIEGKDAKIEHT
VATLLKHAMTAKIKLATGNSFSLSELKEEEKSAELKFHLFLQNLLKESGASLTDGFEHYL
KGAIDLVFVKDQKFYIVDYKSNLLPNNDYSSEAVANAVRDKGYLFQKSVYSFILFEYLKS
LFGPDIALEKFGGVYYLFLRGMLGDNQTGIYSDLKHSDSVWTIEQFEGIKKEVMAYIRSA
SDQLEKVYS
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatggaccatcctttagtcaaccatcccaattttatcgaagcttccgctggaacc
gggaaaacacatctaatcatgcaaatgttaggtgatgtgatgacccatgatgtaacaaat
cataccaaagagaatcgactgcttcaatttttagtgcttacctttacagaaaaagccgca
ggcgaattaaaagcccggttaaaattaaaaatcttagaattatatgagaacggaaaacac
cccgaatactaccattacctccgcgatttagaccaagtcaccatctcgaccatccacggt
ttttgtaatatggtgttaacggaatacccagtcgaaacccaaaacaatcccaatgtaaaa
ttaacatcgaatgaagaattgattcgaaagaccttttatgatctgaaaagaagccaatgg
gaagggagagacaaggaatcacttgcaaacgatattcttatctccaatttaaagaaaaag
gaagacctcgttataagttccacttcgaaactccttgctgatacaaaggactatgtattt
ccggagtttgtatccttagaggaatgcattcacaacgcaaacaaaagtaatctcttagga
gaactcataaccatctgcgaagctttcaaaggaccaaccggtgaagcgattgccgctcaa
ggagctaaaggtagtatcccgaaatggatggaaaattggtcatcactcgagtcatttgca
aaagcgatccgaaacgaagatacaaaatatatagcaaaagaattgaaacgaatttcgaaa
ttaagccgttcccttggaaaagaaggcaaagccagtggattcgattatttccttttggaa
gggagtactaccattgcaaaaaatttagatgcagcatccgttgtgttacaaggaaaaata
aaatctgttgttttatcgctaaaagaaatcttccctcttggccaattggattatgatgga
tccatctttttgcaaaatacagtgcacgaactcacttcgaaaacaaaatccatcatcgaa
aatggcgaatacctgacttatgatcaaatgatcttaaaggtatatgatgtcattgttcgt
aatcccaaccaaatattaattcaatcgttacgagaacgattccaagtttgtatcctggat
gaattccaagacacggacaaaaaccaataccaaatctttaaaactttatttttagacaaa
gatacaaagtccagaatgctcttttgtattggagatccaaaacaaagtatctatggattt
cgcggagctgatattggaatttatctggaagcatctcgtgacttcgaaggatcaaaatcc
accttagaaaccaactataggtccacaaaagaattaatccatggactcaataccattttc
cacgatgaaacaaaagaatggggtgaaactcatttttttcccatcgaagaaccaggctct
agtaaagaaaactatttatataagaaagtatcatcacctgacatcgataccatcaagtac
aagtatgtgaatcctgaggaatcagcgattcatatttttgatttcgaagaacggtttccg
aatgtaaacaaatccagaaatatttgggctgaaacaattcgaaatgaaatcaaacgaatc
caaaacaaggaaacaagtcttctatacaataaaaaaggcgaacgcgaaatccaagagatc
aagttaaaggacattgccatcctttgtgggaataaaaaagaaacagaacttgttgaattt
tatctaacaaaagcgggaatcccctgttccatttacaaacaaagagggatttaccaatcc
agagaagcagatcaaattgaaaatctattggaatgtttacaaagttccaactcctcacaa
agttataaaaaaatcctattctctgatatattctgcatccaccctcatgaaatccaaaag
tttgatgaacactccattgactcctatgaaaaatctctcatcgacaaatggcagagactt
atcaaagaaaatcgatacgcaagtttctttcgttctgtgatggacgaaaccaaactcttt
tggttggaagggaatcatacactggaatgggaacgaaaacgtacaaacttccgacaaatc
tttcaaaaattattagaagtacaactgaaatcaaattgtggcttgttagagttactcgcg
agtttgcgtgagctcaaacaaaaaaaacaatctcccgaagaagagccgttatttgatcgt
gaaacagaagaagattcggtgcaaattttaaccatccatgcatcgaaaggattggaatgg
cctgtcgtattcttattttattttggcaatcgagggaccaatctcaccaatacagaatac
ccaattgaaatagaaacgccagaaggtaaaaaaagaaaatggattcttgacttatgggat
ttgaatccagaaaaagaagacgaagaaaaccatttcctgaatgaacaaaaacgtctgtta
tatgttgccctgacaaggcccaatcttaggttataccttcccaaactcaattgggggagg
tccaaaaaagaagattcgcttccgaattctggttatagccaaatcctctaccaagaatta
attcgaattcaaacccttcaaaatcaaaatccttttcttgagtcgtcttttgtattccga
aatcccaatgaattttcagaatcacaaacaataaaccttcaaacatcaagtgtcacccaa
acgaaaaaaccatctttcccgattctctacccttccgaaatcaaaattggtcgagtgctc
ttgcaacatagttatacaagtttgcaagccaatgaaaaaaacttaaatgtttcccaagag
gaaaagaaaaaagaattagaagaaactcctgatgtagaagtaagcacaacgttcgaattg
ccctcgagtgcgaaggtcggaaactttttacataaaattcttgaattatgtgatttttct
accttccaattggaagtggatgccatcctcgagagtccttcctggaagtgggcgtaccaa
aaatctttcttacgatatccattggaaatcgaaggtaaggatgcaaaaatagagcataca
gtggctactttattgaaacatgcaatgacagcaaagatcaagcttgcgacaggcaactcc
ttctctctcagtgaattaaaggaagaagaaaaatccgcagaattgaaattccatttgttc
ttacagaacttactgaaagaaagtggtgcctccttaacagatgggttcgaacactactta
aaaggcgccatcgatttggtttttgtaaaagatcaaaaattctatattgtcgattataaa
tccaatttgttaccaaacaacgattatagtagtgaagcagtcgcaaatgcagtccgagac
aaaggttatctcttccaaaagtctgtgtattcgtttattttatttgaatacctaaagtct
ctttttggacccgatatagccttagagaagtttggtggagtgtattatttattcttaaga
ggaatgttaggtgacaaccaaacaggcatctactctgatttaaaacattctgattccgta
tggacgatcgaacagtttgaaggaatcaaaaaagaagtgatggcctatatccggagtgcc
tctgaccaattggaaaaggtatattcatga

DBGET integrated database retrieval system