KEGG   Leptospira borgpetersenii JB197: LBJ_0210Help
Entry
LBJ_0210          CDS       T00404                                 

Gene name
icdA
Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj00020  Citrate cycle (TCA cycle)
lbj00480  Glutathione metabolism
lbj01100  Metabolic pathways
lbj01110  Biosynthesis of secondary metabolites
lbj01120  Microbial metabolism in diverse environments
lbj01130  Biosynthesis of antibiotics
lbj01200  Carbon metabolism
lbj01210  2-Oxocarboxylic acid metabolism
lbj01230  Biosynthesis of amino acids
Module
lbj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lbj_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LBJ_0210 (icdA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LBJ_0210 (icdA)
Enzymes [BR:lbj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LBJ_0210 (icdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh cNMP_binding
Motif
Other DBs
NCBI-ProteinID: ABJ74950
UniProt: Q04VX0
Position
1:245536..246732
Genome map
AA seq 398 aa AA seqDB search
MAKIKVKTPLVELDGDEMTRIIWKEIKDRFIHPYLDIELDYYDLGVEHRDKTEDKVTVDS
AHAIQKYGVGVKCATITPNQDRVKEYNLKQEWKSPNGTIRSILDGTVFRKPIIVKNIPPA
VRSWKKPITVGRHAYGDLYKDTELYIPEAGKVELVYTGKDGKEKQRALIHDFDGAGVIMG
QHNLDKSILSFAQACFNYAISEKIDLWFATKDTISKKYHARFRAIFDELARAKAGDLKKA
GIEYSYYLIDDAVAQIMKNEGGMLWALMNYDGDVMSDMVASGFGSLGLMTSVLVSPDGKF
EYEAAHGTVTRHYRKYQQGETTSTNSVASIFAWTGALIKRGELDGTPDVVAFGHKLEKAV
IDTIESGQMTKDLTLLCTDPNAKALDTFQFMEAIQKKL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaattaaggtaaaaaccccgcttgtcgaacttgacggggacgagatgaccagg
atcatctggaaggagatcaaggatcgattcattcatccttatcttgatatcgaactggac
tattatgatttaggcgtggagcatagggataaaaccgaagataaagttaccgtagattcc
gcacacgcgattcaaaaatacggagtgggcgtaaaatgtgcgaccatcactccgaatcag
gatagagtgaaggaatacaacctcaaacaagaatggaaatctccgaacggaacgattcgt
tcgattttggacggaactgtttttcgtaaaccgattatagtaaaaaatattcctcccgcc
gttcgttcttggaaaaaaccgattacggtcggacgtcacgcttatggggatctttataag
gataccgaactttacattccggaagccggaaaagtggaactcgtttataccggaaaagac
ggaaaggaaaaacaaagagccttgatccacgacttcgacggagcgggtgtgattatgggt
cagcataacttggataagtccattcttagttttgctcaagcttgtttcaattatgcgatt
tccgaaaaaatcgatctttggttcgcgacgaaagacaccatttctaaaaagtatcatgct
agatttcgggcgattttcgacgaacttgcaagagccaaagccggagatctcaaaaaagcc
ggaatcgaatattcgtattatctcatagacgacgcggtcgctcaaattatgaaaaacgag
ggcggaatgctctgggcgctgatgaactacgacggagacgtgatgagcgatatggtggca
tccggattcggatctttgggactcatgacttccgtacttgtttctccggacggaaaattc
gaatatgaagccgctcacggaactgtaaccagacattaccgtaaatatcaacaaggtgaa
actacttccacaaattcagtcgcttccatttttgcttggacaggggcattgatcaaaaga
ggagaattggatggaactccggatgtagttgcgtttggtcataaacttgaaaaggcagtg
atcgacacgatcgaaagcgggcaaatgacaaaggatttaacgcttctttgtacggatcca
aatgcaaaagctctggatacctttcagtttatggaagcgattcagaaaaaactctaa

DBGET integrated database retrieval system