KEGG   Leptospira borgpetersenii JB197: LBJ_0289Help
Entry
LBJ_0289          CDS       T00404                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj00071  Fatty acid degradation
lbj00280  Valine, leucine and isoleucine degradation
lbj00310  Lysine degradation
lbj00360  Phenylalanine metabolism
lbj00362  Benzoate degradation
lbj00380  Tryptophan metabolism
lbj00410  beta-Alanine metabolism
lbj00627  Aminobenzoate degradation
lbj00640  Propanoate metabolism
lbj00650  Butanoate metabolism
lbj00903  Limonene and pinene degradation
lbj01100  Metabolic pathways
lbj01110  Biosynthesis of secondary metabolites
lbj01120  Microbial metabolism in diverse environments
lbj01130  Biosynthesis of antibiotics
lbj01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LBJ_0289
   00650 Butanoate metabolism
    LBJ_0289
  Lipid metabolism
   00071 Fatty acid degradation
    LBJ_0289
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBJ_0289
   00310 Lysine degradation
    LBJ_0289
   00360 Phenylalanine metabolism
    LBJ_0289
   00380 Tryptophan metabolism
    LBJ_0289
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LBJ_0289
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LBJ_0289
   00281 Geraniol degradation
    LBJ_0289
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LBJ_0289
   00627 Aminobenzoate degradation
    LBJ_0289
   00930 Caprolactam degradation
    LBJ_0289
Enzymes [BR:lbj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LBJ_0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABJ75019
UniProt: Q04VQ1
Position
1:351255..352082
Genome map
AA seq 275 aa AA seqDB search
MKAHFEFFEIVVRPEDKTAVLYLNRPEKRNAMDWPFWRDLPDVIEEINANPDIHAFVIAA
KGKSFSIGLDLDSFIQQFGSLIQAPLGSDRRKFFDLILKMQKGINAVYDSPKPSIAAVQK
HCIGGGLDLISACDIRYATTDASISLREAKVAIVADMGSINRLPSIIGQGNTRELALTGK
DIDGTEAERIGLVTKVFQTQEEMMEVALATAKEIAENPKIVVSGVKDVMRYSEGKPLEAG
LNYVALWNSSFLDSVDFRKAVQSFRERKRPVYNQD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcccattttgaatttttcgaaattgtcgtaagacctgaagataaaaccgccgtt
ctttatctcaaccgccctgagaaaagaaacgcaatggattggcctttctggagggatcta
ccggatgtgattgaagagatcaatgcgaatcctgatattcacgcgtttgtgattgctgca
aagggaaaatccttttccatcggtttagatctggattcctttatccaacagtttggcagt
ttgatccaagctcccttaggtagtgaccgtagaaaattcttcgatctcattcttaaaatg
caaaagggtatcaacgccgtttacgattcaccaaaaccgtccattgccgctgttcaaaaa
cattgtatcggtgggggattggatctgatttccgcctgtgatattcgttacgctacgaca
gacgcgtcaatttccctccgggaggcaaaagttgcgattgttgccgatatgggttcgatc
aacagactcccttctatcattggacaaggcaatacacgagaattggctttaactgggaaa
gatatcgacggaacggaggcggagcgaatcggactcgtaaccaaggtttttcagacccaa
gaagaaatgatggaagttgcccttgcaactgcaaaagagatcgccgaaaatcctaaaatc
gtcgtgtctggcgtgaaggatgtaatgagatattctgaaggaaaaccgctggaagccggt
ttgaattatgttgcactttggaattcgagtttcctcgattccgtggattttagaaaggcg
gtacaatcttttcgggaacgcaaacgtcccgtttacaatcaagactga

DBGET integrated database retrieval system