KEGG   Leptospira borgpetersenii JB197: LBJ_0684Help
Entry
LBJ_0684          CDS       T00404                                 

Gene name
recB
Definition
(GenBank) Exodeoxyribonuclease V, beta chain
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    LBJ_0684 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lbj03400]
    LBJ_0684 (recB)
Enzymes [BR:lbj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LBJ_0684 (recB)
DNA repair and recombination proteins [BR:lbj03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LBJ_0684 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 PDDEXK_1 UvrD_C_2 AAA_30 AAA_11 ResIII DUF2075
Motif
Other DBs
NCBI-ProteinID: ABJ75359
UniProt: Q04UR1
Position
1:complement(820089..823253)
Genome map
AA seq 1054 aa AA seqDB search
MNVRRSYELKSCFIEASAGTGKTYTIMEIVKDLIGEHGIPLTQILILTYTEKAAGELKER
LRKKLIASDLTKEARELDQVTISTIHGFCNMILQEYPVETETPSKWILTDSKERLNSALY
KLQHEEWSSWVNHPEELETFLSLSGYISKKENILIAGSKLLSGKKYPYSNETTPMNAETF
RQKTALIAAEMVAREFKTSEWMSYDQMILQTRDSLKNPHLCKALQSRYKVGIIDEFQDTD
SVQYEIFSKLFLEPNNETEQKILYLIGDPKQSIYGFRGADIGTYLRAKKELKSHKAQEIS
LNVNYRSVPELICAYNELFGGKTGEQSFFPIVERSFESTPIEYSEVSAPEKNPKILLSDK
HRQGPIQIVRFIGKDTWKTNDAKNAWGRFIGEEILKLTRSENPFSYQILEESDEKIHFAE
KKLNFREIAILVKSKAEGKLAEQSLKLRGIPCSFYKQEGIYQSPESYQISNIFECLLDPN
KPSSYRKLLLGDLFQIHPDHLVAFDEHSIESYEKTTLDRWKTLAIDRKFPELFRSIEEDS
RIFLTEDETDIDWERKKTNYGQIFRKLLQFQIANQAGLEEILEELKLLQIESKNEQEPPL
FEKETEKDAVQILTLHSSKGLEWPVVFLFHLSSNFVPEIYDYPVTEKDGERYWKLSLWDN
EEEKKISKEEYSYQSLNENKRLLYVGITRPQVRLYLPFYTPTNHKKTKDSAYYKILYPRL
RHILENEPDPSLFHPIAWTPISFDQTDPNIRNRTRDSEVRLTPLLHCESEPSKTIRLHSY
SSLKTRAKTSENESLSILEEAEYFKSDDAEGAETEDALPSSAATGSFLHALLEELDFSFF
KTKTPREVLKNRKVLSRMDFHLNYFRLSKENKKNTLSEKETYQKRAGEILWNSLNANIPL
QDKTSFSLVDLGKENRISEMDFHLSLDPTGKNLLKGSIDLVFEIKNKFYIADYKSNLLED
YSPLSLRRSVENTENRYDLQRDIYAMVLYEYLKDLFGPKDVFQKIGGVYYFFLRGMKHGE
NSGIYSDFHWSPDRMETIHKIVRELTAVHWLEDL
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttagacgttcttatgagcttaaatcctgctttatcgaagcgtccgcaggcacg
ggcaaaacgtatacgatcatggaaatcgtaaaagatctgatcggcgaacacgggattcct
ttaactcaaatcctgattttaacctatacggaaaaggcggcgggagaactcaaagagagg
cttagaaaaaaactcatcgcgtccgatcttacaaaagaagcgagagaactagatcaggtt
acaatttccaccatacacggtttttgtaatatgattctgcaggaatatccggtggaaacg
gaaacaccttccaaatggatcttaaccgattcgaaagaaagactgaactcggctttgtat
aagctccaacacgaagaatggagctcttgggtgaatcatccggaagaactcgaaacgttt
ctttccttatccggatatatatcaaaaaaagagaatattctcatcgccggctccaaactt
ttgagcggaaaaaaatatccgtattccaacgaaacaactccaatgaatgcggaaacgttc
cgtcaaaaaacggcgttgatcgcagcggaaatggttgcacgggaatttaaaacgtccgaa
tggatgagttacgaccagatgattttgcaaacgagagactctctaaaaaatccccatctt
tgtaaggctcttcaaagcagatataaagtcggaattatagacgagtttcaggatacggat
tcggttcaatatgaaattttctccaaactctttttggaaccgaacaacgaaacggaacaa
aaaattctttatctcatcggagatcctaaacaatcaatttacgggttcagaggagcggat
atcggaacctatctccgagcgaagaaggaattgaaaagtcataaggctcaagagatttcg
ttgaacgtcaattataggtccgttccagagttgatttgcgcttataatgaattattcggc
ggtaaaaccggagaacaaagtttttttccgatcgtagaacgaagtttcgaatcgactcca
atcgaatactcggaggtttccgctcccgaaaaaaacccgaaaattttattaagcgacaaa
cataggcaaggcccgattcaaatcgtacgttttatcggaaaagatacctggaaaacgaac
gatgcaaaaaacgcttggggtcgattcatcggcgaagaaatcttgaaacttactcgaagc
gagaatccgttttcgtatcaaattttagaagaatccgacgaaaaaattcattttgcggaa
aaaaaactgaactttagagaaatcgcgattctcgttaagagtaaggcggaaggtaaactt
gcggagcaatctttaaaactcagagggattccttgctcgttttataaacaagaggggatc
tatcagtctcccgaatcgtatcagatttccaatatatttgaatgtcttttggatccgaat
aaaccctcctcctatcgaaaacttctattgggtgatctgtttcaaatccatcccgatcat
ctagtcgcatttgacgaacattcgatagagtcctacgaaaaaaccactttggaccggtgg
aaaaccctcgcgatcgatcgtaaatttcccgagctgttccgctccatagaggaagacagc
agaatattcctaaccgaagacgaaacggatatagactgggagaggaaaaagacgaactac
ggacaaattttccgcaaattgcttcagttccaaatcgctaatcaagccggcctggaggaa
atattagaagagttgaaactacttcagatcgagtccaaaaatgaacaagagcctccctta
ttcgaaaaagaaaccgaaaaagacgccgttcaaattctcactttgcactcttccaaaggt
ttggaatggcccgtcgtttttctattccatctttccagcaatttcgttccggagatctac
gattatccggttacggaaaaagacggagaaagatactggaagttaagcctttgggacaac
gaagaagaaaagaaaattagtaaagaagaatattcttatcagtccctgaacgaaaacaaa
agacttttgtacgtagggatcacccgcccgcaagtcagactataccttcccttctacact
cccacaaaccataaaaagacgaaagattccgcatattataagattctgtatcctagatta
cggcacattttggaaaacgaaccggacccgagtttgtttcatccgatcgcttggactcct
atttctttcgaccaaacggatccgaatatacgaaatcgaactcgggattctgaagttcgt
ttaacaccgctgctacactgcgaatccgaaccttccaagacgattcgtttgcacagttat
tcttctctaaaaaccagggccaaaacctcggaaaatgaatctctttccattttggaagaa
gcggaatatttcaaatccgacgacgcggaaggcgctgaaactgaagatgcacttccttcg
tcggcagcaaccggctcttttttacacgctcttttggaagaattggatttctcttttttt
aagaccaaaacaccaagggaagttttaaagaaccggaaagttctttctagaatggatttc
catttaaattattttaggctttcaaaagaaaataaaaagaacaccctctcggaaaaagaa
acatatcaaaaaagagccggagaaatcctttggaattccctaaatgcaaatattcctctc
caggacaaaacctcgttcagccttgtggatcttggtaaagaaaataggatttcggaaatg
gactttcatttaagcctggacccgacgggcaaaaatcttttaaaaggttccatcgattta
gtctttgagatcaaaaataaattctatatagccgattacaaatcaaatctgctcgaagac
tattctcctctttcattacgaaggagtgtggaaaacacggagaaccgatacgacctacaa
agagacatctatgcgatggtactttacgaatatctaaaggacctattcgggcctaaagac
gtttttcaaaagatcggaggagtatattacttttttctaagaggaatgaaacacggagag
aactccggaatttattcggactttcattggagtccggacagaatggaaacgatccacaaa
atcgtacgggaactgactgccgttcactggttggaggatctttga

DBGET integrated database retrieval system