KEGG   Leptospira borgpetersenii JB197: LBJ_0910Help
Entry
LBJ_0910          CDS       T00404                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj00900  Terpenoid backbone biosynthesis
lbj01100  Metabolic pathways
lbj01110  Biosynthesis of secondary metabolites
lbj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBJ_0910 (dxr)
Enzymes [BR:lbj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     LBJ_0910 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABJ75554
UniProt: Q04U66
Position
1:1092805..1093974
Genome map
AA seq 389 aa AA seqDB search
MTTSVSLLGASGSVGESTLRVLRAYPQEFRLHSFSVHSNLEKAREIQKEFSPEFLCVSDS
TADRTVLGNKIGKTQVLYGESALCELVREPEVQIVITAIVGSVGLRPTIAAITSGKRLGI
ANKETLVTFGPLVNSLIAKHKTKVVPVDSEHNALFQLLESLNRDSVEKIVLTASGGSFRD
LSVEQLAYVTKEQALHHPTWNMGPKITVDSNGMINKGLEVIEAHFLFGVPYERIGVVIHP
QSIAHGIVELKDGASFVYASYPDMIFPIAHSLFHPEPVPKSLRSYSAKDWGKLEFWEPDL
KRYPGLGLAFEAGKAGGTAPCIFNAANEAAVELFLKDEIRFTEIPDYIWYTLDEMPIDFP
TSLEEYEEVDRIARKTVLNLKARKVVSAC
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttccgtcagtcttttaggtgcgtccggttccgtaggggaatccactcttagg
gtgctccgtgcttatccccaagaattccgtcttcattctttcagcgttcattcgaatctg
gaaaaggccagagaaattcaaaaggaattttctccggaatttctctgcgtgagcgacagc
accgcggaccgcaccgttctcggaaataaaatcggcaaaacacaagtcctttatggagaa
tctgctctttgcgagcttgttcgagaacccgaagttcaaatcgtaatcaccgctatcgta
ggttccgtgggtttacgtccgacgatcgccgcgatcacttccggtaaaagattaggaatc
gcgaataaagaaacattagtcacatttggcccgctcgtcaattctttgattgcaaaacat
aaaaccaaagtggttccggtcgattcggagcataacgctctctttcaacttttggaatct
ttgaaccgcgactctgtggagaagatcgttctaacggcgtcgggcggttcgttccgggat
ttatccgtagaacaacttgcgtatgttacgaaagaacaagcgcttcatcatcctacttgg
aacatgggacctaagatcaccgtggattccaatggtatgattaacaaaggactcgaagtc
atcgaagctcattttttgttcggagttccttacgagcgcatcggagtcgtgattcatcct
cagagtatcgcgcacggtatcgtggaattaaaagacggcgcttcgttcgtttatgcttct
tacccggatatgatttttccgattgcacattctctctttcatccggaaccggttcctaag
tcgcttcggtcctattccgctaaggattggggaaaactggaattttgggagccggattta
aaacgatatccgggacttggattagcgtttgaggcgggtaaggcgggggggacggctccc
tgcatttttaacgcggccaacgaggcggccgtggaattgttcttaaaggatgagatccgt
tttacggagattccggattatatctggtacacattagatgaaatgccgatcgattttccg
acttctttggaagaatacgaggaagtcgatcggatcgcccgtaaaaccgtcctaaatctg
aaagcaaggaaggtggtgtccgcatgttaa

DBGET integrated database retrieval system