KEGG   Leptospira borgpetersenii JB197: LBJ_0914Help
Entry
LBJ_0914          CDS       T00404                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj00260  Glycine, serine and threonine metabolism
lbj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lbj01100  Metabolic pathways
lbj01110  Biosynthesis of secondary metabolites
lbj01130  Biosynthesis of antibiotics
lbj01230  Biosynthesis of amino acids
Module
lbj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBJ_0914 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LBJ_0914 (trpA)
Enzymes [BR:lbj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LBJ_0914 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA DUF561 His_biosynth BtpA Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ABJ75558
UniProt: Q04U62
Position
1:1098632..1099426
Genome map
AA seq 264 aa AA seqDB search
MSAISSVFSSDKSVFIPYISLGDPDYESCISWADALIRGGAGILELGIPFSDPVADGPVI
QKAFKRALAYPFSMKKILEITAEIHKLHPETPLVYLTYFNPLYSMGLEAFTESAKNSGIQ
GLIIPDLPFDTSEAEEFFSQLERKKIDFIHLVTPATTIDRIQSMKSFASGFIYYVTSYGV
TGERRALAVGLKERIQMVRNKVGLPVCAGFGISTADQAKEISTYANGVIIGSAVQKIIEE
SGSNREVCISKLFTYASEIRASMK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgctatttcttccgttttttcctccgataaaagcgttttcattccttatatctct
ttgggagatccggactacgagtcttgtatttcttgggcggatgctctgattcgaggtggt
gctggaattttagaattgggaattccattttccgatccggtcgcggatggcccggtgatt
caaaaagcctttaaacgagcgttggcttatcctttctccatgaaaaaaattttagagatc
accgcagaaattcataaattacatccagaaactcctctcgtgtatttaacgtattttaat
ccgctttattctatgggtttggaagcttttacggagagtgcaaaaaattcggggatccaa
ggtttgattatcccggaccttccgtttgacacctcggaagcagaagagtttttttctcaa
cttgaacgaaaaaagatcgatttcattcatcttgtaactcctgcaactactatcgatcgg
attcaatctatgaaatcttttgcatccggttttatctattatgtgacttcctacggtgtc
accggggaacgtcgtgctctcgcggtcggtttgaaagaacggattcaaatggtgcgtaac
aaggtcggcctcccggtttgcgcggggttcggaatttccactgcggaccaggctaaggaa
atttcgacttacgcgaatggggtgattatcggttctgccgtacaaaaaatcatcgaagag
agtggctccaatcgggaagtttgcataagtaaactttttacgtatgcatcggaaattcgt
gcttctatgaaatga

DBGET integrated database retrieval system