KEGG   Leptospira borgpetersenii JB197: LBJ_1373Help
Entry
LBJ_1373          CDS       T00404                                 

Gene name
rpsU
Definition
(GenBank) 30S Ribosomal protein S21
  KO
K02970  small subunit ribosomal protein S21
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lbj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LBJ_1373 (rpsU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lbj03011]
    LBJ_1373 (rpsU)
Ribosome [BR:lbj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    LBJ_1373 (rpsU)
  Bacteria
    LBJ_1373 (rpsU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S21
Motif
Other DBs
NCBI-ProteinID: ABJ75954
UniProt: Q04T16
Position
1:1631605..1631814
Genome map
AA seq 69 aa AA seqDB search
MVGIIVKDGESIESALKRFKRDCANAGIMSEIKRREYFEKPSIKKKKAIESAKRKAEKKK
RLFSKKDKA
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atggtaggaatcattgtaaaagacggagaatcgatcgaatctgctttgaaacgtttcaag
cgtgactgcgcgaatgcaggtattatgagcgaaattaaacgaagagaatactttgaaaaa
ccgagtatcaaaaagaaaaaagcgatcgagtccgcaaaaagaaaagcagaaaagaaaaaa
cgtcttttctcaaaaaaagataaggcttaa

DBGET integrated database retrieval system