KEGG   Leptospira borgpetersenii JB197: LBJ_2640Help
Entry
LBJ_2640          CDS       T00404                                 

Gene name
rplO
Definition
(GenBank) 50S Ribosomal protein L15
  KO
K02876  large subunit ribosomal protein L15
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lbj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LBJ_2640 (rplO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lbj03011]
    LBJ_2640 (rplO)
Ribosome [BR:lbj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LBJ_2640 (rplO)
  Bacteria
    LBJ_2640 (rplO)
  Archaea
    LBJ_2640 (rplO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L27A
Motif
Other DBs
NCBI-ProteinID: ABJ77063
UniProt: Q04PV7
Position
1:complement(3150945..3151487)
Genome map
AA seq 180 aa AA seqDB search
MKKERLEQAAAFGKERAKKKKNTDTTSNLVPVPKGAKKEKKRVGRGPGSKVGKTAGRGSK
GQYARNTVRRGFEGGQMPIHRRLPKRGFTAKFHKEFYPVNLRDIEKSGLTGNIDAKIMVQ
SKILDKETTLFKILGTGEIKKAIHVIADGFSQSAKEKIEKAGGSIKLRAEIELAASETKK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaagactcgagcaagcggcggcgttcggtaaagaacgcgcaaaaaagaag
aaaaacaccgacactacttccaatctggttcccgttcctaagggagcgaaaaaagagaag
aagagagtgggacgcggtccgggctcgaaagtcggtaaaaccgcgggccgcggatccaaa
ggacagtatgcaagaaatacagttcgtcgcggattcgaaggtggtcagatgccgatccac
agaagacttccgaaacgcggttttacagccaagtttcacaaggaattctaccctgtgaac
ctgagagacatcgagaaatcaggtttgaccgggaacatagatgcaaaaattatggttcaa
tccaagattcttgataaagaaacgacactttttaagattttggggaccggagaaatcaaa
aaagcgattcatgtaattgcggacggattttctcaatcggctaaagaaaaaatcgagaaa
gctggcgggtctatcaaattgcgcgcagaaatcgaattagccgcgtctgaaacgaaaaaa
taa

DBGET integrated database retrieval system