KEGG   Leptospira borgpetersenii JB197: LBJ_2643Help
Entry
LBJ_2643          CDS       T00404                                 

Gene name
rplR
Definition
(GenBank) 50S Ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lbj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LBJ_2643 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lbj03011]
    LBJ_2643 (rplR)
Ribosome [BR:lbj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LBJ_2643 (rplR)
  Bacteria
    LBJ_2643 (rplR)
  Archaea
    LBJ_2643 (rplR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L18p rve
Motif
Other DBs
NCBI-ProteinID: ABJ77066
UniProt: Q04PV4
Position
1:complement(3152202..3152570)
Genome map
AA seq 122 aa AA seqDB search
MIDKLKKSVSKIRRAERSRFKLKKSGSRPRLVFNKSNKYLSCQIVDDIQGVTLAYATTSE
KTFSSEGKSKKDVGAAKVLGKLIAERGSQKGVKQVMLDRSGMIFHGRIAAFAEGAREAGL
EF
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgattgataaactgaaaaaaagtgtttctaaaatcagaagagcggaacgttcccgattt
aaactcaaaaaatccggaagccgccctcgtttggtttttaataaatcgaataagtatctg
agctgtcagatcgtcgatgacattcaaggtgtgactctcgcttatgcgactacttccgaa
aaaactttttctagcgaaggaaaaagcaaaaaggacgtgggagctgcgaaagttctcgga
aagttgatcgctgagagaggatcccaaaagggggtgaaacaagtcatgctggatcgttcc
ggaatgatctttcacggaagaatcgccgctttcgcagaaggcgcgagagaagcaggactg
gagttctaa

DBGET integrated database retrieval system