KEGG   Leptospira borgpetersenii JB197: LBJ_2958Help
Entry
LBJ_2958          CDS       T00404                                 

Gene name
btuE-1
Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj00480  Glutathione metabolism
lbj00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LBJ_2958 (btuE-1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LBJ_2958 (btuE-1)
Enzymes [BR:lbj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LBJ_2958 (btuE-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABJ77355
UniProt: Q04P15
Position
1:complement(3512527..3513012)
Genome map
AA seq 161 aa AA seqDB search
MTQTLYDLTATLNSGKEQRLEDYRGKVLLIVNTASECAFTPQYAGLQSLYSKYKTEGLEI
LGFPCDQFKHQEPGSDETIKNFCQKNYGVEFPIFKKINVNGDSAHPVFRFLRKKASGFFG
NSIKWNFTKFLVDKQGNVIKRYSPITTPEKIEKVIQDLLKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaacattatacgatttaacggctactttgaatagtggtaaagagcagagattg
gaagattataggggaaaggttctcttaatcgtaaatactgcgagtgaatgtgcttttact
cctcaatatgcgggcctgcaaagtttatacagtaaatacaaaacggaagggttagaaatt
ctcggatttccttgcgatcagttcaaacatcaggaaccgggttcggatgagacgattaag
aatttttgccaaaaaaactatggagttgaatttccgatttttaaaaaaatcaatgtgaat
ggagatagcgcccatccggtgtttcggtttttgagaaagaaagcttccggatttttcgga
aactcgatcaaatggaattttacgaagttcttggtagataaacaaggaaatgtaattaaa
cgttattctcccattaccacgccggaaaagatcgaaaaagttatccaagaccttttaaaa
aaataa

DBGET integrated database retrieval system