KEGG   Lactobacillus brevis KB290: LVISKB_0461Help
Entry
LVISKB_0461       CDS       T02528                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lbk  Lactobacillus brevis KB290
Pathway
lbk00450  Selenocompound metabolism
lbk00970  Aminoacyl-tRNA biosynthesis
lbk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LVISKB_0461
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LVISKB_0461
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lbk01007]
    LVISKB_0461
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lbk03016]
    LVISKB_0461
Enzymes [BR:lbk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LVISKB_0461
Amino acid related enzymes [BR:lbk01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LVISKB_0461
Transfer RNA biogenesis [BR:lbk03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LVISKB_0461
 Prokaryotic type
   Other AARSs
    LVISKB_0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: BAN06096
UniProt: M5AYC2
Position
477822..479855
Genome map
AA seq 677 aa AA seqDB search
MADKPSFYITTPIYYPSGRLHIGNSYTTIACDTVARYKRSNGYDVFFLTGTDEHGLKIED
KAKAQNQTPQEYVDGMATGIKQLWKTLEISNDKFIRTTDHEHVAAVQAIFDRLLKQGDIY
LGEYEGWYSEDDEEYFTETQLAKVYRDADGKMIGGQAPSGHDVSLVKEQSYFFKMSKYAD
WLLDFYHSHPHFIQPESRMTEMINNFIKPGLEDLAVSRTTFSWGVPVKSDPKHVVYVWID
ALLNYITALGYTSDDDGLFKKFWPADVQMVGKEIVRFHSIYWPIVLHALGLEMPKELFAH
GWLLMKDGKMSKSKGNVIYPETLVDRYGLDALRYYLMRAMPYGNDGVFSPEDFVDRLNYD
LANDLGNLLNRTVAMINKYEGGQLPQYQAGVTEFDADLEATAAAVITNYHDLMNQMHFAD
ALAEIWKLVARSNKYIDETEPWKLAKDDSKATELAAVMAHLAASLRVIATLISPVMTHAP
KEIFDQLGLDVATLTMTDLALADLPAGKQVVAKGTPIFPRIDVQEEVDFIQGKMTKSEKT
KGRAAMAAKAEAQQAANEPAAEDLTLTKPEIRFDKFEKIELRVAEIKAVDHVDGADKLLK
FQLDAGDQGTRQILSGIAEWYPEPQELVGKKVVIVANLKPRKMRGQVSQGMLLSAENDGQ
VTLLTLPDSLVNGSDVS
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaaaccaagtttttacattaccacgccgatttactacccatctggacggtta
catatcggtaattcttatacgacaattgcgtgtgacacggttgctcgttacaagcggagc
aatgggtatgatgtgttcttcttaaccgggacagatgaacatggcctgaagattgaagat
aaggccaaggcccaaaaccaaacgcctcaagaatatgtagacggcatggcgacgggcatt
aagcagctgtggaagacgttagagatttccaatgacaagttcattcggacaacagaccat
gaacacgtggccgctgttcaggcgatctttgaccggttactcaaacagggtgatatttac
ctgggtgaatatgaaggctggtactccgaagatgatgaagaatactttacggaaacccaa
ttggccaaagtctatcgggatgccgatggcaaaatgatcggtgggcaagcgccttctggt
catgacgtctctctagtaaaggaacaatcctacttcttcaaaatgagtaagtatgctgac
tggttgttggatttctaccacagccatccgcactttatccaaccagaatcacgaatgaca
gaaatgattaataacttcatcaagcctggattggaagacctcgctgtttcgcggacaact
ttcagctggggggtaccagtcaagagtgatcctaagcacgttgtttacgtgtggattgac
gctcttttaaactatatcaccgcgttgggttacactagtgatgatgatggcctctttaag
aagttctggcccgctgatgtgcaaatggtgggtaaagaaattgttcgtttccattccatc
tactggccaattgtgctccatgccttagggctagaaatgcccaaggaattatttgcccac
ggttggttattgatgaaagacggcaagatgtctaaatctaagggtaacgtgatttatcca
gaaaccttggttgatcggtatgggttggatgcgttgcggtactatctgatgcgagcaatg
ccttacggtaatgatggggtcttttcaccagaagactttgttgatcggctaaactatgat
ttggctaatgatttggggaatctattgaaccgaaccgttgcaatgattaacaaatatgag
ggtggtcaattaccacaatatcaagctggagttaccgagtttgatgctgatttggaagcc
acagcagccgcagtcatcacgaactatcatgacttgatgaaccaaatgcattttgctgat
gctttggcagaaatttggaagttagtggcgcggagtaacaagtatatcgatgaaacggaa
ccttggaagttagccaaagatgatagcaaggctacagagttggctgctgttatggctcat
ttggctgctagcttgcgggttattgccacgcttatcagtccagttatgacgcatgcccct
aaggaaatctttgaccaattgggcttagacgttgccaccttaacgatgacggacttggcg
ttagctgatctaccagcaggtaagcaagtcgtcgctaagggaacccctattttcccacgg
attgatgtgcaagaagaagtcgactttattcagggtaagatgaccaagtcagaaaagacg
aagggacgggcagccatggccgctaaagcagaagcccaacaggccgctaatgaaccagcg
gctgaggacttaaccttaaccaagccggaaattcggtttgataagttcgaaaaaattgaa
ttacgagtcgctgaaatcaaagccgttgaccatgttgacggggctgataaattactgaag
ttccaattagatgctggcgatcaggggacccggcaaattctttccggaattgctgagtgg
tatccagaaccacaagaactagtgggcaagaaggtcgtcattgtggcaaacttgaagcca
cgaaagatgagaggacaagttagtcaagggatgttattgtctgccgaaaacgatggacaa
gtgaccttgctgaccttacctgacagtctggttaacggttctgacgttagctag

DBGET integrated database retrieval system