KEGG   Lactobacillus brevis KB290: LVISKB_1624Help
Entry
LVISKB_1624       CDS       T02528                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lbk  Lactobacillus brevis KB290
Pathway
lbk03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lbk00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LVISKB_1624
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lbk03011]
    LVISKB_1624
Ribosome [BR:lbk03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LVISKB_1624
  Bacteria
    LVISKB_1624
  Archaea
    LVISKB_1624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: BAN07259
UniProt: M5AER5
Position
complement(1642085..1642441)
Genome map
AA seq 118 aa AA seqDB search
MAEQVTSAQATAKTVRIAARKVRLVIDLIRGKSVAEALAILQFTPRGASPVVAKVLNSAV
ANAENNFDLDRQDLVVSEAYVNEGPTLKRFRPRAKGSASPINKRTSHITVVVSEKEEG
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaagttacatcagcacaagcgactgctaaaacagttcggattgctgctcgc
aaagtccgccttgtcatcgatcttatccgcggcaagagcgtcgctgaagcactagctatt
ttgcagttcacaccgcgtggtgcttcaccggttgtggcaaaggtattgaactctgcagtt
gcaaacgcagaaaataattttgacttagatcgtcaagatctagttgttagcgaagcctat
gtgaacgaaggaccaaccctcaagcggttccgtcctcgtgccaaaggttctgcttcacca
atcaacaagcgtacgagtcacattacggttgttgtatctgaaaaagaggagggataa

DBGET integrated database retrieval system