KEGG   Lactobacillus brevis KB290: LVISKB_1987Help
Entry
LVISKB_1987       CDS       T02528                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lbk  Lactobacillus brevis KB290
Pathway
lbk00480  Glutathione metabolism
lbk00590  Arachidonic acid metabolism
lbk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    LVISKB_1987
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LVISKB_1987
Enzymes [BR:lbk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LVISKB_1987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: BAN07622
UniProt: M5AH28
Position
complement(2005275..2005775)
Genome map
AA seq 166 aa AA seqDB search
MNCRKDWVLMTMIYDFQETEMSGQPLNLADYRGKVVLIVNTASKCGLAPQLVGLEDLYQR
YHSQGLEVLGLPSNQFHQELESDEATSDFCQVHYGVTFPMTKKIQVNGADEDPLFTYLKK
TAGHGRIKWNFTKFLIGRDGQLIARYAPTTKPEKIEPAIVTALQPD
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtagaaaggactgggtgctaatgacgatgatttacgatttccaagaaactgaa
atgagtggtcaaccgctcaatttggcagactatcggggaaaagtcgtactgattgtgaat
acggctagtaaatgtggactggcaccacaactggtggggctagaagacttgtatcagcga
tatcatagtcagggtcttgaagttttgggcttgccgtccaaccaatttcatcaggaacta
gaatcggatgaggcaaccagtgatttttgtcaggttcattatggggtaacctttcccatg
acgaaaaaaattcaagtcaatggggcagatgaagatccgttattcacgtacctcaagaaa
acagcgggtcacggtcgaatcaaatggaactttacgaagtttcttattggtcgtgacgga
cagctcattgcgcggtacgcccccacgaccaagccagagaaaattgaaccagcgattgtg
acggcgttacagcccgattag

DBGET integrated database retrieval system