KEGG   Lactobacillus brevis KB290: LVISKB_2289Help
Entry
LVISKB_2289       CDS       T02528                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lbk  Lactobacillus brevis KB290
Pathway
lbk00071  Fatty acid degradation
lbk00072  Synthesis and degradation of ketone bodies
lbk00280  Valine, leucine and isoleucine degradation
lbk00310  Lysine degradation
lbk00362  Benzoate degradation
lbk00380  Tryptophan metabolism
lbk00620  Pyruvate metabolism
lbk00630  Glyoxylate and dicarboxylate metabolism
lbk00640  Propanoate metabolism
lbk00650  Butanoate metabolism
lbk00900  Terpenoid backbone biosynthesis
lbk01100  Metabolic pathways
lbk01110  Biosynthesis of secondary metabolites
lbk01120  Microbial metabolism in diverse environments
lbk01130  Biosynthesis of antibiotics
lbk01200  Carbon metabolism
lbk01212  Fatty acid metabolism
lbk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lbk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LVISKB_2289
   00630 Glyoxylate and dicarboxylate metabolism
    LVISKB_2289
   00640 Propanoate metabolism
    LVISKB_2289
   00650 Butanoate metabolism
    LVISKB_2289
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LVISKB_2289
   00072 Synthesis and degradation of ketone bodies
    LVISKB_2289
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LVISKB_2289
   00310 Lysine degradation
    LVISKB_2289
   00380 Tryptophan metabolism
    LVISKB_2289
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LVISKB_2289
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LVISKB_2289
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LVISKB_2289
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lbk04147]
    LVISKB_2289
Enzymes [BR:lbk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LVISKB_2289
Exosome [BR:lbk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LVISKB_2289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III PsbW
Motif
Other DBs
NCBI-ProteinID: BAN07924
UniProt: M5AGF1
Position
2287824..2288993
Genome map
AA seq 389 aa AA seqDB search
MAEEVVIVSAARTPIGKFGKSLRGLSAEQLGTIAAKAAITRSGLDPATIQQTIFGSVLQA
GQGQNIARQIELNAGLPVTSTAMTINQVCGSSLKAIRLGQSAILMGDADIVLVGGTESMS
NAPYLTPQTRWGHKFGDITLTDSLAHDGLTDAFTDIPMGITAENVAAQFHISRADQDAFA
LRSQRRATAAQQANRFADEIVPVSLGTTTLTTDEAVRTTTSREQLAALRPAFKSVGTVTA
GNAAGLNDGAAAMILMKKSTARAAGIAYLATLRGYQEVGIDPAIMGYAPVTAIQQLLTKT
QRSVSDIDRFELNEAFAAQSVAVGQALALPDDRLNVNGGAIALGHPLGASGTRIVVTLLY
ELLHSGTHLGVASMCIGGGMGMALMIESN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaagttgttattgtcagtgcggcacgcacccccattggcaaatttggtaaa
agtttaaggggcttaagcgccgagcaattaggtactatcgctgccaaagccgcgattacc
cgcagtgggttagaccccgccacaattcagcagaccatctttggttcagtcttacaggct
ggtcaagggcaaaacattgcccgacaaattgaacttaacgctggtcttcccgtcactagc
accgcgatgaccattaatcaggtttgtggctccagcctaaaagccatccgtttgggccaa
agcgccatcctcatgggtgatgccgacattgttctagtcggtggcaccgaaagcatgagc
aatgccccttatctcacgccgcaaacacgttggggtcataaatttggtgatattacgctc
actgatagtctagcccatgacggcttgaccgacgccttcaccgacatccccatggggatc
accgctgaaaacgttgcagctcaatttcatattagccgtgctgatcaagatgctttcgca
cttcgttcccaacggcgtgcaaccgctgcacaacaagccaatcgttttgccgacgagatc
gttcccgtctccttaggcaccaccacgttaacgaccgatgaagccgtgcgcaccacaact
tcacgcgaacaacttgccgcactccggcccgcttttaaatccgttggcaccgttactgcc
ggcaatgccgctggcttaaacgatggggccgctgccatgattctcatgaaaaaatcaacc
gcccgagccgccggtattgcgtatctcgcaacgctccgtggctaccaagaagtcggcatt
gacccggccatcatgggctacgcccccgtcacagcaatccaacaactcttaaccaaaacc
cagcgatccgtcagtgacattgatcgttttgaattaaatgaagcctttgccgcccaatcc
gtcgcggttggtcaggcactggcacttcctgatgaccgcctaaacgttaatggcggggcc
attgctttgggtcatccactaggtgcttctgggacccgcattgtagtcaccttactctat
gaactcctgcacagtggcactcacttaggtgtcgcctcaatgtgtattggcggtggcatg
gggatggcgctgatgattgaatccaactaa

DBGET integrated database retrieval system