KEGG   Leptospira borgpetersenii L550: LBL_0106Help
Entry
LBL_0106          CDS       T00405                                 

Gene name
btuE-1
Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
lbl00480  Glutathione metabolism
lbl00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LBL_0106 (btuE-1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LBL_0106 (btuE-1)
Enzymes [BR:lbl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LBL_0106 (btuE-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABJ77727
Position
1:119763..120248
Genome map
AA seq 161 aa AA seqDB search
MTQTLYDLTATLNSGKEQRLEDYRGKVLLIVNTASECAFTPQYAGLQSLYGKYKTEGLEI
LGFPCDQFKHQEPGSDETIKNFCQKNYGVEFPIFKKINVNGDSAHPVFRFLRKKASGFFG
NSIKWNFTKFLVDKQGNVIKRYSPITTPEKIEKVIQDLLKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaacattatacgatttaacggctactttgaatagtggtaaagagcagagattg
gaagattataggggaaaggttctcttaatcgtaaatactgcgagtgaatgtgcttttact
cctcaatatgcgggcctgcaaagtttatacggtaaatacaaaacggaagggttagaaatt
ctcggatttccttgcgatcagttcaaacatcaggaaccgggttcggatgagacgattaag
aatttttgccaaaaaaactatggagttgaatttccgatttttaaaaaaatcaatgtgaat
ggagatagcgcccatccggtgtttcggtttttgagaaagaaagcttccggatttttcgga
aactcgatcaaatggaattttacgaagttcttggtagataaacaaggaaatgtaattaaa
cgttattctcccattaccacgccggaaaagatcgaaaaagttatccaagaccttttaaaa
aaataa

DBGET integrated database retrieval system