KEGG   Leptospira borgpetersenii L550: LBL_0149Help
Entry
LBL_0149          CDS       T00405                                 

Gene name
ilvC
Definition
(GenBank) Ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
lbl00290  Valine, leucine and isoleucine biosynthesis
lbl00770  Pantothenate and CoA biosynthesis
lbl01100  Metabolic pathways
lbl01110  Biosynthesis of secondary metabolites
lbl01130  Biosynthesis of antibiotics
lbl01210  2-Oxocarboxylic acid metabolism
lbl01230  Biosynthesis of amino acids
Module
lbl_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    LBL_0149 (ilvC)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LBL_0149 (ilvC)
Enzymes [BR:lbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     LBL_0149 (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C AdoHcyase_NAD F420_oxidored NAD_binding_2 CoA_binding CoA_binding_2 Oxidored_nitro ELFV_dehydrog Mur_ligase FMO-like NAD_binding_7 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ABJ77767
UniProt: Q056H8
Position
1:175773..176774
Genome map
AA seq 333 aa AA seqDB search
MANIYYDADCDLSSLKGKTIAVIGYGSQGHAQAQNMKDSGLKVIIGLKEGSKSIQDAKNA
GFEVYSVAEASQKADVIQILAPDTIQADLYKKDIEPNLKKGNALVFSHGFNIHYDFIKPP
EEVDVYMVAPKGPGHLVRRVYTEGGGVPCLIAVHQDSTGEAKKRALAHAAGVGGGRAGIL
ETSFREETETDLFGEQVVLCGGLSNLIMAGFETLTEAGYDPEIAYFECLHEVKLITDLIY
EGGLARMRFSISDTAEYGDYVSGPRVIDPGVKQRMKEVLNDIQKDKGAKFATNWMAETKA
GYPNFKNMRDKNAAHPIESVGKKLRSMMKWLSK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatatctattacgacgccgattgtgatttaagctctctaaaaggaaaaaccatc
gcagtaatcggttacggaagtcagggacatgctcaggctcaaaatatgaaagattccggg
cttaaagttatcattggtttaaaagaaggatccaaatcaattcaagatgccaagaatgca
ggctttgaagtatacagtgttgccgaagcttctcaaaaagcggatgtcatacaaattctc
gccccggatacgattcaagcggatctttataaaaaagatattgaaccgaatctgaaaaaa
gggaatgcactcgttttttctcacggattcaacattcactacgatttcatcaaacctcct
gaagaggtggatgtttatatggttgctcctaaaggtccgggccatcttgttcgtagagtt
tatacggaaggcgggggagttccatgtttgattgcggttcatcaggattcaactggcgag
gctaaaaaaagggcgcttgctcatgccgccggtgtcggaggcggtcgtgcaggaattttg
gaaacatcttttcgtgaagaaaccgaaacggacttattcggagaacaggttgttctttgc
ggcggtctttccaatctaatcatggccgggtttgaaactttaaccgaagcaggttatgat
cctgaaatcgcgtacttcgagtgtcttcatgaagtgaaactcatcaccgatctcatctac
gaaggcggattggcaagaatgaggttttctatttccgataccgcggaatacggcgattac
gtaagcggcccgcgcgtaattgacccaggtgtaaaacaaagaatgaaagaagttctgaac
gatattcagaaagataagggagcaaaattcgcaaccaactggatggctgaaacgaaagcc
ggttacccaaactttaaaaatatgagagataagaacgcggctcatccgatcgaatcggtt
ggtaaaaaactgagaagtatgatgaagtggttatctaagtaa

DBGET integrated database retrieval system