KEGG   Leptospira borgpetersenii L550: LBL_1316Help
Entry
LBL_1316          CDS       T00405                                 

Definition
(GenBank) Bifunctional dihydrolipoyllysine-residue acetyltransferase/dihydrolipoyllysine-residue succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
lbl00010  Glycolysis / Gluconeogenesis
lbl00020  Citrate cycle (TCA cycle)
lbl00620  Pyruvate metabolism
lbl01100  Metabolic pathways
lbl01110  Biosynthesis of secondary metabolites
lbl01120  Microbial metabolism in diverse environments
lbl01130  Biosynthesis of antibiotics
lbl01200  Carbon metabolism
Module
lbl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBL_1316
   00020 Citrate cycle (TCA cycle)
    LBL_1316
   00620 Pyruvate metabolism
    LBL_1316
Enzymes [BR:lbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LBL_1316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABJ78808
Position
1:complement(1545027..1546442)
Genome map
AA seq 471 aa AA seqDB search
MAKIAEMTQLSPTMSEGKIVRWLKQKGDSVSPGEIIAEVETDKAVMEMEAFETGVLLEIL
APEGSLLPVGAPVAIIGKPGEDVSALVEIAKKSIPAKKEGSAAPSQTSTSTQSTSSSTAP
TSSAQSGTSASTSGAGAGKNLETKTSVSLSQNAGNSGITANEERTYGFKTSPSFGPGESE
HSPVRSARGGRPIKASPLAKNLALQKGINLTEVIGSGPGGRIIKRDILSYQSGGGNTFVK
RQDRKLEITGMRKTIASRLAHSTSTIPHFYLTTELNAGPIDDLRNSINRDLGLSGQGKVS
VNDLILKACSYTLLQVPEVNSSWREDHILEHGRVDIGVAVSIEGGLITPYIRNAEEKSVL
EISREIKELASRARDRKLKPGEYTDGTFTVSNLGMFGVSSFTAVINEPEAAILAVGALVE
KPVLKAGNIVPGKILNVTLSCDHRVIDGATGSRFLSLFREFMEHPLRLLTG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaattgcagagatgactcaactcagtcccacgatgtcggaaggaaagatcgtc
cgatggctcaaacaaaaaggagattccgtttctcccggagaaatcatcgcggaggtggaa
acggacaaagccgtcatggaaatggaagcctttgaaaccggtgttcttttggaaattttg
gctccggaaggaagccttcttccggtcggggcgcccgtcgcaatcatcgggaaaccggga
gaagatgtttctgcattagtcgaaatcgcaaagaaatccattcccgccaaaaaggaaggt
tccgccgcgcctagccaaacttcaacctcaacacaaagcacgtcatcctcaacagctccg
acttcttccgcacaaagtggaacttctgcctcaacgtccggcgcaggcgcaggtaaaaat
ctcgaaacaaaaacaagcgtttctctttcgcagaatgccggaaacagcggcataaccgca
aacgaagaacgaacttacggattcaaaacgtcgccctcattcggcccgggagaatcggaa
cattctcctgttcgatccgcacgcggcggacgtccgatcaaagcctcccctttggcaaaa
aatctcgcccttcaaaaaggaatcaatctcacagaagtgatcggctctggtcccggagga
aggatcatcaaacgagacattctctcctatcagtcaggtggcggaaatacttttgttaag
cgacaagaccgtaagttggaaatcacgggaatgagaaagacaatcgcttcccgtcttgca
cattccacttcgaccatccctcatttttatcttacgacggaattgaatgcgggtccgatc
gacgatctcagaaactccatcaatagggatctcggactcagcggccagggaaaagtcagc
gtaaacgatctcattctcaaagcgtgttcttatactttgttgcaagtcccggaagtgaat
tcttcctggagagaagatcatatcttagagcacggaagagtcgatatcggagtcgcagtt
tccatcgaaggaggtctcattactccttatattcgaaacgcagaagagaaatccgtcctc
gaaatcagtcgagagataaaagaacttgcgtcccgggcaagagacagaaaactcaaaccg
ggggaatacacggacggcacctttaccgtctccaacctcggaatgtttggagtctcttcc
ttcaccgcggtcatcaacgaacccgaagcggcaattcttgcggtaggcgctctcgttgaa
aaaccggtgctcaaggctggaaacatcgttccgggaaaaatcttgaacgttacgctttct
tgtgatcacagagtcatagatggagcgacgggatctagatttctttccttattccgagag
tttatggagcatccccttcgcctacttacaggctaa

DBGET integrated database retrieval system