KEGG   Leptospira borgpetersenii L550: LBL_4186
Entry
LBL_4186          CDS       T00405                                 

Gene name
htpX
Definition
(GenBank) Zn-dependent protease with chaperone function
  KO
K03799  heat shock protein HtpX [EC:3.4.24.-]
Organism
lbl  Leptospira borgpetersenii L550
Brite
KEGG Orthology (KO) [BR:lbl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lbl01002]
    LBL_4186 (htpX)
Enzymes [BR:lbl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     LBL_4186 (htpX)
Peptidases and inhibitors [BR:lbl01002]
 Metallo peptidases
  Family M48: Ste24 endopeptidase family
   LBL_4186 (htpX)
SSDB
Motif
Pfam: Peptidase_M48 Peptidase_M56 Peptidase_M1 SprT-like DUF4157 DUF1689 BSP
Other DBs
NCBI-ProteinID: ABJ80501
UniProt: Q04WP4
Position
2:complement(215528..216415)
AA seq 295 aa
MWFKRIGLFLLTNILVVVTISIVTSVLGIGPYLDANGLNLSSLVIFCFLWGMGGAFVSLL
LSKFMAKMMMGVQIIDPRSASGAERELYSRVERLARAANLPMPEVGIYHSPEVNAFATGP
SKSSSLVAVSSGLLQVMDNAEVEGVLAHELAHVANGDMVTMTLIQGIVNAFVMFFSRIIS
YALSTMVKDEMQYTVRLISNIVLSILFSILGSIVVAYFSRTREYRADAGGAKLVGRQNMI
AALEKLRRTFDAPEDERGKEALATMKISGHNKWMALFSTHPPLEARIAALKNSGY
NT seq 888 nt   +upstreamnt  +downstreamnt
atgtggtttaaacgaattgggttatttttactgaccaatattctagtagttgtaacgatt
tcgatcgttacgagcgtgcttggaatcggtccatatttggatgcaaacggacttaatctg
agttccttagttatcttctgttttctctggggtatgggaggtgcgtttgtatctctactt
ctctccaagtttatggctaagatgatgatgggagtgcagatcatcgatcctagatctgcg
tccggtgctgaaagagaattgtattctagagtagaaagacttgcaagagcggcaaacctt
ccgatgcccgaagtgggaatttatcattctccggaagtaaatgcatttgcgaccggacct
tccaagtccagttctcttgttgcggtatctagcggtttacttcaggtgatggacaacgcg
gaagtggaaggtgttctcgcgcacgagttggcgcacgttgcaaacggagacatggtgaca
atgactctgattcagggtattgttaacgcttttgtaatgttcttttcaaggatcatcagt
tacgctttgagtacgatggttaaagacgaaatgcaatacacagtacgtctgatttccaat
atcgtcttaagcattctgttcagtattctcggatcgatcgtagtcgcgtatttctcaaga
accagggaataccgtgcggatgcaggcggagcaaaactcgtaggacgtcagaatatgatt
gcggctcttgaaaaactaagacgtacatttgacgcacctgaggatgaaaggggcaaggaa
gctcttgctacaatgaaaatatccggacataacaaatggatggccctattttcaactcac
cctcctttagaagcgagaattgcggctctaaagaactcaggatattaa

DBGET integrated database retrieval system