KEGG   Lactobacillus buchneri CD034: LBUCD034_2098Help
Entry
LBUCD034_2098     CDS       T02244                                 

Definition
(GenBank) putative (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
lbn00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LBUCD034_2098
Enzymes [BR:lbn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LBUCD034_2098
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LBUCD034_2098
    1.1.1.-  
     LBUCD034_2098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N AlaDh_PNT_C Pyr_redox_2 2-Hacid_dh_C ADH_N_assoc ApbA ADH_N_2 ELFV_dehydrog DUF2045
Motif
Other DBs
NCBI-ProteinID: AFS01081
UniProt: J9WAJ6
Position
2093555..2094625
Genome map
AA seq 356 aa AA seqDB search
MKAVRIYGEKDIRVEDVEIPEPKDDQVQIKVKYCGICGSDLHAYLEGWGLPTVPYPLTGK
TVPITLGHEFSGEIVKVGKDVDDLQVGDHVAVEPLLACGKCENCRAGNYNFCNRAVSTDG
AGNFLGFSEDGGMAEFANVQGVFAHKMPKDMDFELGALAEPTAVVYEAIKKSHLREGQNV
AVMGAGPIGLLEAVLAKIAGANHVYIVDVSKVRLDKAKELGIEHVLDPSQDDVEKIIKQD
LPNGVDITFECAGVQATFDSALKVTKRTGIIQVVALYAKPVTMNMTDDLIMQGKDVITTL
CYNNSFPNVLGIIDNHKDLFKKVVTKKISLDNALEDGIKALSTDKSQVKIMIDPSL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtacgtatttatggtgaaaaggatatcagagttgaagacgttgagattcca
gaaccaaaggatgatcaagttcaaattaaagttaaatattgtggaatttgtggaagtgat
ttgcacgcctatctcgaaggctggggcctgccaaccgttccttatccgttaaccggtaaa
accgtgccaattacgctggggcacgaattctcaggtgaaattgttaaagtcggtaaagac
gttgacgacttacaagttggtgaccacgttgccgttgaaccacttttagcttgcggcaaa
tgtgaaaactgtcgggcaggaaactataacttctgtaaccgtgccgtttcaactgatggc
gccggcaacttcctgggcttctcagaagatggtgggatggctgaatttgccaacgttcaa
ggggtctttgcccacaagatgccaaaagacatggactttgaattaggtgctttggcagaa
ccaaccgccgttgtttacgaagctatcaagaagagtcatttgcgtgaaggccaaaacgtt
gctgtcatgggagccggcccaattggcttgctggaagctgttttagctaagatcgcaggt
gccaaccacgtatacatcgttgatgtttccaaagttcgtttggacaaagccaaggaatta
ggcattgaacatgtccttgacccaagccaagacgacgttgaaaagatcatcaaacaagac
ttaccaaatggtgtggacattaccttcgaatgtgccggcgttcaagcaaccttcgattca
gcattgaaagttacgaagcgaaccggaattattcaagtagttgccctctatgcaaaacca
gttaccatgaacatgactgatgacctgattatgcaaggtaaagacgttatcacaaccctc
tgctacaacaactcattcccgaatgtgttaggcattattgataatcacaaggatctgttc
aagaaagtggtcactaagaaaattagcttggataatgcattggaagacggcattaaagct
ctctcaaccgataaatcacaagttaagattatgatcgatccatcactgtaa

DBGET integrated database retrieval system