KEGG   Lactobacillus buchneri CD034: LBUCD034_2285Help
Entry
LBUCD034_2285     CDS       T02244                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
lbn00071  Fatty acid degradation
lbn00072  Synthesis and degradation of ketone bodies
lbn00280  Valine, leucine and isoleucine degradation
lbn00310  Lysine degradation
lbn00362  Benzoate degradation
lbn00380  Tryptophan metabolism
lbn00620  Pyruvate metabolism
lbn00630  Glyoxylate and dicarboxylate metabolism
lbn00640  Propanoate metabolism
lbn00650  Butanoate metabolism
lbn00900  Terpenoid backbone biosynthesis
lbn01100  Metabolic pathways
lbn01110  Biosynthesis of secondary metabolites
lbn01120  Microbial metabolism in diverse environments
lbn01130  Biosynthesis of antibiotics
lbn01200  Carbon metabolism
lbn01212  Fatty acid metabolism
lbn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBUCD034_2285 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    LBUCD034_2285 (atoB)
   00640 Propanoate metabolism
    LBUCD034_2285 (atoB)
   00650 Butanoate metabolism
    LBUCD034_2285 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LBUCD034_2285 (atoB)
   00072 Synthesis and degradation of ketone bodies
    LBUCD034_2285 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBUCD034_2285 (atoB)
   00310 Lysine degradation
    LBUCD034_2285 (atoB)
   00380 Tryptophan metabolism
    LBUCD034_2285 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBUCD034_2285 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LBUCD034_2285 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LBUCD034_2285 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lbn04147]
    LBUCD034_2285 (atoB)
Enzymes [BR:lbn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LBUCD034_2285 (atoB)
Exosome [BR:lbn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBUCD034_2285 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFS01255
UniProt: J9W8U0
Position
2306863..2308047
Genome map
AA seq 394 aa AA seqDB search
MKKIVIIDAKRSAIGKLNGSLSSLTAEQLGSKVTRALLKDAGLSGSQVDQVIFGNAIQAG
NGQNIARQIELNSQIPESKTAFTVNQVCGSGLQAIHQAQSALLLGEAETVIAGGTESMSN
VPYLNMSQRKTTKFGPVTLYDGLQRDGLNDSATDEPMGMTAENVADQYHVSREEQDAFAL
RSHQLAAQATEQHYFDDEIIPIELNQPKSHAPHIVAQDESIRVDTNLEKLAALRPAFKPN
GSVTAGNSAPLNDGAAALIMMTEDRANQLGLSPMAEVLGYAEHGINPEVMGYAPYLAINQ
LVSQLNMSVNDIDLYEINEAFASQSVAVVRDLGISLDKVNINGGAIALGHPLGDSGARIV
TTLLHNLRRTNQEFGVASLCMGGGMGSALAIKLL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaattgtaattatcgatgccaaacgatcagccatcggcaaattaaacggctca
ttatcttcattaactgccgaacaacttggttcaaaagtcacgcgtgctttattaaaagat
gctggtctttccggcagccaagttgatcaagttatctttggcaacgccatccaggccgga
aatggccaaaacattgcccgacaaatcgaattgaacagtcagattccagaaagtaaaaca
gctttcacagtcaaccaagtctgtggatcaggactacaggcaatccatcaagcacaatcc
gccttgcttctcggagaagcggaaacggtcattgccggcggaaccgaaagcatgtccaac
gttccttacttgaacatgtcacaacgaaagacaaccaagtttgggccggtcacattatat
gatggactgcaacgagacggcctaaatgattcagcgacggatgaaccaatgggaatgacc
gctgagaacgttgccgatcaataccatgtctcacgtgaagaacaggatgcttttgcattg
cgatcacatcaactggctgcgcaagctactgaacagcattattttgatgatgaaattatt
cccattgaactcaaccaacccaaatcacacgctccccacatcgtagcgcaagatgaatcg
atccgggtcgacacaaatttggaaaaactggccgcccttcgtcccgcttttaaaccgaac
ggatccgtcactgccggcaacagtgcaccactaaacgacggggctgctgctctgatcatg
atgactgaagaccgggcaaaccagttgggactatctccaatggcagaggtgctgggttac
gccgagcacgggatcaacccggaagtcatggggtatgcgccctacttagccattaatcaa
ttggtatcccagctcaacatgtcagtcaacgacattgacctctatgaaatcaacgaggcc
tttgcttcccaatcagtagcagttgttcgtgatttaggtatttcacttgataaagtgaac
attaacggcggtgcaatcgcactgggtcatcctctcggagattctggtgcccgcatcgtg
acgacgttattgcataatctgcgccggaccaaccaagaatttggcgttgcctctctttgt
atgggcggcggcatgggatcggcgctggcaatcaaacttctttaa

DBGET integrated database retrieval system