KEGG   Leptolyngbya boryana: LBWT_16290Help
Entry
LBWT_16290        CDS       T04848                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
lbo  Leptolyngbya boryana
Pathway
lbo00220  Arginine biosynthesis
lbo01100  Metabolic pathways
lbo01110  Biosynthesis of secondary metabolites
lbo01130  Biosynthesis of antibiotics
lbo01230  Biosynthesis of amino acids
Module
lbo_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:lbo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    LBWT_16290
Enzymes [BR:lbo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     LBWT_16290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: BAS55724
Position
1740921..1741856
Genome map
AA seq 311 aa AA seqDB search
MGSLKGRDLLKLSDLSPDEVMELLEIAAQLKSGKLNPRITVNGHPPVLGLLFYKASTRTR
VSFSTAMYHLGGQVLDLPLNATQVSRGEPIEDTARVLDRYLDILAIRTFEQSDLDTFAQE
MQIPVINALTDLEHPCQVLADLQTIQETFSTLSGLTLTYVGDGNNVAHSLMLGCALVGMN
VRIATPIDYRPLPEIVQLTEKIANGKSEVLLTDDPIAAAKDSHVLYTDVWASMGQEDLAE
SRIPIFQPYQVNSELMSYADKDAIVLHCLPAHRGEEITEDVIEGSQSKVWDQAENRMHAQ
KALMASLLGAV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgggttcacttaaaggacgggatttattgaaattgtcagatctcagcccagacgaagtg
atggagttgctagagattgcagcacagcttaaatctggaaaattaaacccacggatcacg
gtcaacggtcatccgcccgtgttgggattgctgttctataaagcctcgactcgaacccgt
gtgagcttctcaactgccatgtatcaccttggaggacaagttcttgatttgcccttgaat
gccactcaggtgagccgtggagaaccgatcgaagataccgcaagagtcctcgatcgctac
ctcgacatcttggcaattcgtacctttgagcagtcagatctcgacacattcgctcaagaa
atgcagattccagtcatcaatgccctgacggatttagagcatccttgccaggttttagcc
gacttacaaacgattcaagaaaccttttcgaccctttccggtttgacgctgacgtatgtc
ggagatggcaataatgtcgcgcattcgctcatgttgggctgtgccttagtgggtatgaat
gtccgaattgcaactcctatagactaccgacctctgcccgaaattgtgcaactgacggaa
aaaattgccaacggtaaatccgaagtgctgttaaccgatgatccgatcgcggccgcaaaa
gattcccatgtgctctataccgatgtctgggcaagtatgggacaagaggatctcgccgaa
agccgaattccgatttttcagccttaccaagtgaattccgagttgatgagctatgcggac
aaagacgcgatcgtgctgcactgtcttccggcacatcggggcgaagaaatcaccgaggat
gtgatcgaaggctctcaatcgaaagtttgggatcaagccgaaaatcgtatgcacgctcaa
aaagcgctcatggcaagtttgctcggtgcagtctga

DBGET integrated database retrieval system