KEGG   Leptolyngbya boryana: LBWT_16990Help
Entry
LBWT_16990        CDS       T04848                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
lbo  Leptolyngbya boryana
Pathway
lbo00780  Biotin metabolism
lbo01100  Metabolic pathways
Module
lbo_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:lbo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LBWT_16990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lbo01007]
    LBWT_16990
Enzymes [BR:lbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     LBWT_16990
Amino acid related enzymes [BR:lbo01007]
 Aminotransferase (transaminase)
  Class II
   LBWT_16990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 OKR_DC_1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAS55793
Position
1811916..1813079
Genome map
AA seq 387 aa AA seqDB search
MKNDPYAWLEQSLKSIERAGWQRSTQTIDRPGAVIQIDNRQFLNFASNDYLGLATDDRLI
NAAIQAIQNYGTGSTGSRLLTGHRALHRELETAIAQLKQAEDAIVFSSGYLANLGAIAAL
VGKRDLILSDQYNHSSLRNGAIVSGATTLDYAHCDIQDLRTKLEQQRQHFQHCLIITDTV
FSMDGDLCPLPEILDLADEFECMVLVDEAHATGVMGATGAGCVEHLGCTGRAIVQMGTLS
KALGSLGGYIAGSAQLIDFLRNRAPSWIYTTGLSPADTAAALAAIQIVQQERDRRNILWQ
NVAYLKSQLPNFALLPSESPILCWQLPNVQTALEAAKSLQAEGIFAPAIRPPTVPTSRIR
MTIMATHEKAHLDRLVAALNRVQKDVE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgatccttatgcttggcttgagcagtccttaaagtcgatcgagcgtgcgggt
tggcagagatcgactcaaaccattgatcgtccgggtgcagtgattcaaattgacaatcgt
caatttctcaattttgccagcaatgattatttaggacttgccaccgacgatcggttaatc
aatgccgcgattcaagcgattcagaactatggaactggcagtactggatcgcgcttgctt
actgggcatcgggctttacatcgagagttagaaactgcgatcgcacaactcaaacaagct
gaagatgcgatcgtatttagttcaggctatttagcaaatttaggcgcgatcgctgcttta
gtcggaaagcgcgacttaattctgtctgatcaatacaatcattcgagcttacgaaatggt
gcgattgttagcggggcaacaacgctcgactatgctcattgtgatattcaagacttacga
actaagctagaacaacaacgccaacattttcagcattgtttgatcattacagacacagtg
tttagtatggatggcgatctctgcccgcttccagagattcttgacctagcagatgaattt
gaatgcatggtgctagtagacgaagctcatgcaacgggtgtaatgggtgcaacaggtgca
ggatgtgttgaacatttaggctgtacaggtcgcgcgatcgttcagatgggaacgctcagc
aaggcattaggaagtctaggcggttacattgctggctcagcgcaattgattgatttctta
agaaaccgcgcacccagttggatctatacaactgggctgtctccggctgatactgcggcg
gcattagcagcaattcaaattgtgcaacaagaacgcgatcgccgaaatatcctttggcag
aatgttgcttatctcaaatcacagcttccaaatttcgcacttctcccttcagagtctccg
attctctgctggcaattgccgaatgtgcaaactgcattagaagctgcaaaatctctacaa
gctgaaggaatcttcgcccctgcaatccgcccgccgactgtgccgacgagccggattcgg
atgacgataatggcaactcatgagaaagcgcatctcgatcgcttagttgctgctttgaat
cgagttcagaaagacgttgagtaa

DBGET integrated database retrieval system