KEGG   Leptolyngbya boryana: LBWT_28750Help
Entry
LBWT_28750        CDS       T04848                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
lbo  Leptolyngbya boryana
Pathway
lbo00670  One carbon pool by folate
lbo01100  Metabolic pathways
lbo01120  Microbial metabolism in diverse environments
lbo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LBWT_28750
Enzymes [BR:lbo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     LBWT_28750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: BAS56948
Position
3075673..3076638
Genome map
AA seq 321 aa AA seqDB search
MTYPQISQPLGHAPLSAFRTAARNGEFLVTAEVAPPKGTDPTHMVQMAQVLKGRVHAVNI
TDGSRAVMRMSSLVSAALLLQQGIEPVYQVACRDRNAIGLQADLLGAHALGIRNVLALTG
DPLKAGDHPESKAVFELESVRLLQMISKLNGGSDWNDKELTDGETDLFVGAAVDPQCASW
SGLQRRFERKIQAGAQFFQSQLITDFERLDKFMNEIAAGCNKPVLAGIFLLKSAKNARFI
NRAVPGVNIPDHIIDRLEKASDPLREGMVIAAEQVKLAKEVCQGVHMMAVKREDLIPEIL
DLAGIPAIAKQTELISAVTLS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcctcaaatctcacagcccctcggtcacgccccgctttctgcgttccgtaca
gccgctcgaaatggcgaatttcttgtcactgctgaagttgcgcctcccaaaggcactgat
ccaactcatatggtgcagatggcgcaagtgcttaagggaagagtacatgcggtcaatatt
acagatggcagtcgggctgtgatgcggatgtcttcgctcgtttcggcagcattgcttttg
cagcaaggaattgaacctgtttatcaagttgcttgtcgggatagaaatgcgatcgggcta
caagcggatctgctcggtgctcatgctttggggattcggaatgttttagctttaacgggt
gatccgttaaaggcaggggatcatcctgagtcgaaagcggtgtttgagcttgaatcagtg
cgcttgttgcagatgattagtaagctcaatggcggcagtgattggaacgataaagaattg
acggatggagagacggatctgtttgttggtgcagcagttgatccacaatgtgcgagttgg
tcagggttacagagacgatttgagcggaaaatacaagcaggggcacagtttttccagagt
cagttgattactgattttgagcgattggataaatttatgaacgagattgctgcggggtgc
aataagcctgtgttagctggaattttcttactgaagtcggcaaaaaatgcgcggtttatt
aatcgggcggttccaggggtgaatattccagaccatattatcgatcgcttagaaaaagct
tctgatcctttacgtgaaggaatggttattgcggctgagcaagtcaaactggcaaaagag
gtctgtcagggtgtgcatatgatggcagtaaagcgcgaagacttaattccagagattcta
gatctggcaggtattccagcgatcgcaaagcaaactgaactaatctcagcagtaactctt
agctag

DBGET integrated database retrieval system