KEGG   Leptolyngbya boryana: LBWT_34890Help
Entry
LBWT_34890        CDS       T04848                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lbo  Leptolyngbya boryana
Pathway
lbo00480  Glutathione metabolism
lbo00590  Arachidonic acid metabolism
lbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    LBWT_34890
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LBWT_34890
Enzymes [BR:lbo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LBWT_34890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: BAS57531
Position
complement(3713833..3714327)
Genome map
AA seq 164 aa AA seqDB search
MTAQASSSIYDFSANSLEGQPVSLSTFKDKVLLIVNTASQCGFTPQYQGLQSIYNKFENQ
GFAVLGFPCNQFGQQEPGTASEIQSFCETRFGVTFPLFEKVDVNGSNAHPLFKYLTKSAP
GIFGTEGIKWNFTKFLVDRSGKVVKRYPSTTKPEEIEKDIQALL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcaagcatcttcttcaatttatgatttctcagcgaatagcttagaaggtcag
cccgtttcactcagcacgttcaaagataaagtattgctgatcgtgaatactgcaagtcaa
tgtggatttacaccacagtatcaaggcttacaatcgatttacaacaagtttgagaatcaa
ggatttgcagttttgggatttccctgtaatcagttcgggcaacaagaaccgggaaccgca
agtgaaattcaatccttctgtgaaactcgctttggcgtgacattccccttgtttgaaaaa
gtcgatgtcaatggcagcaatgctcacccgctgtttaagtatttgaccaaatctgcaccg
ggcatctttggaactgaaggaatcaagtggaacttcacgaaattcttagtcgatcgctct
ggtaaggtcgtcaagcgttatccgtctacaaccaaaccagaagaaatcgaaaaagatatt
caagcgctgctctaa

DBGET integrated database retrieval system