KEGG   Lonsdalea britannica: CKQ53_02645Help
Entry
CKQ53_02645       CDS       T05623                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
lbq  Lonsdalea britannica
Brite
KEGG Orthology (KO) [BR:lbq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CKQ53_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AXW85985
Position
561938..562315
Genome map
AA seq 125 aa AA seqDB search
MINAPRVCIQVQSFYVEAQSAPEEDRYVFAYTITIRNLGRHDVKLMSRYWLITNSNGRQT
EVQGEGVIGVQPVIHPGSEFQYTSGAILETPLGTMEGHYQMLDHQGETFQESIPVFRLAI
PSLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgcgccccgagtttgcatacaggttcagagtttctacgtagaagcacagtct
gcgccggaagaagatcgctacgtctttgcttacaccatcacgatccgcaatctgggacgc
cacgacgtcaaactgatgagccgttactggctcatcaccaacagcaacgggcgtcagact
gaagttcagggcgaaggcgtcatcggcgttcagcccgtcattcatcccggcagtgaattc
caatacaccagcggcgccattctcgaaacgccgttgggaacgatggaaggccactaccag
atgctcgaccatcagggtgagactttccaggaatctatcccggtattccgtctggcaatc
ccttcactgatacactaa

DBGET integrated database retrieval system