KEGG   Lonsdalea britannica: CKQ53_03505Help
Entry
CKQ53_03505       CDS       T05623                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lbq  Lonsdalea britannica
Pathway
lbq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lbq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CKQ53_03505 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lbq03011]
    CKQ53_03505 (rplV)
Ribosome [BR:lbq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CKQ53_03505 (rplV)
  Bacteria
    CKQ53_03505 (rplV)
  Archaea
    CKQ53_03505 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AXW86137
UniProt: A0A1X3RPL2
Position
complement(748341..748673)
Genome map
AA seq 110 aa AA seqDB search
METIAKHRHARSSAQKVRLVADLIRGKKVSQALEILTYTNKKAAGLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatcgctaaacatcgccacgctcgttcttctgctcaaaaggtacgcctggtg
gcggacctgattcgcggtaagaaagtgtcgcaagctctggaaattctgacctacaccaac
aagaaagctgctggtctggttaaaaaagtactggagtctgctattgctaacgcagaacac
aacgatggcgctgacattgatgatctgaaagttgcgaaaatcttcgttgacgaaggcccg
agcatgaagcgcattatgccgcgtgccaaaggtcgtgcggatcgcatcctgaagcgtacc
agccacatcactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system