KEGG   Lonsdalea britannica: CKQ53_05910Help
Entry
CKQ53_05910       CDS       T05623                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
lbq  Lonsdalea britannica
Pathway
lbq00540  Lipopolysaccharide biosynthesis
lbq01100  Metabolic pathways
Module
lbq_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:lbq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CKQ53_05910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:lbq01005]
    CKQ53_05910
Enzymes [BR:lbq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     CKQ53_05910
Lipopolysaccharide biosynthesis proteins [BR:lbq01005]
 Unusual sugar
  CKQ53_05910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR ThiF adh_short
Motif
Other DBs
NCBI-ProteinID: AXW86574
UniProt: A0A1X3S4Q6
Position
complement(1266953..1267885)
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNDTGYRDILVVDNLKDGTKFANLADLDIADYIDKEDFIANI
VAGDDLGDIEAIFHEGACSSTTEWDGKYMMDNNYQYSKEVLHYCLERSIPFLYASSAATY
GGRSNNFVEERQFEQPLNVYGYSKFLFDQYVREILPHAGSQICGFRYFNVYGPREGHKGS
MASVAFHLNQQIHQGENPKLFSGSENFKRDFVYVADVAAVNLWFWKQGVSGIFNCGTGRA
ESFQAVADAVLDYHKTGSVEYIPFPEKLQGRYQSYTQADLTKLRAAGYDKPFHSVAEGVA
DYMAWLNRDA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgtgactggcggcgccggtttcatcggcagcaatatcgtgaaagcgttgaat
gacacgggttaccgcgacattctggtagttgataacctgaaagacggcaccaagttcgcc
aacctggcggatctggatatcgccgactacatcgataaagaagatttcatcgccaatatc
gtcgccggcgacgatttgggtgatatcgaagcgattttccacgagggcgcctgctcttcc
accaccgagtgggacggcaagtacatgatggataacaactatcagtactccaaagaggtg
ctgcattactgtctggaacgcagcattcccttcctgtatgcctcttccgccgccacctac
ggcggacgcagcaacaacttcgtggaagagcgtcagttcgaacagccgctgaatgtttac
ggctactccaagttcctgttcgatcagtacgtgcgtgaaattctgccgcacgcgggctcc
cagatctgcggtttccgctattttaacgtctacggaccgcgtgaaggccataaaggcagc
atggccagcgtggcgttccacctaaaccagcagatccatcagggcgaaaatccgaagctg
ttctctggtagcgaaaacttcaagcgcgacttcgtttatgtcgccgacgtcgccgccgtg
aacctatggttctggaagcagggcgtctccggtattttcaactgcgggaccggccgtgct
gagtcattccaggccgtcgccgacgccgtactggattaccacaaaaccggcagcgttgag
tacattcccttcccggaaaaactgcagggtcgctatcagtcctacacgcaggcggatctg
accaaactgcgcgcggccggttatgacaaaccgttccactccgtcgctgaaggcgtagcc
gactacatggcctggcttaaccgcgacgcataa

DBGET integrated database retrieval system