KEGG   Lonsdalea britannica: CKQ53_08290Help
Entry
CKQ53_08290       CDS       T05623                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
lbq  Lonsdalea britannica
Pathway
lbq00051  Fructose and mannose metabolism
lbq00520  Amino sugar and nucleotide sugar metabolism
lbq01100  Metabolic pathways
lbq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CKQ53_08290
   00520 Amino sugar and nucleotide sugar metabolism
    CKQ53_08290
Enzymes [BR:lbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     CKQ53_08290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 AraC_binding Cupin_3
Motif
Other DBs
NCBI-ProteinID: AXW86981
Position
1791006..1792412
Genome map
AA seq 468 aa AA seqDB search
MLLPVIMAGGTGSRLWPLSRELYPKQFICLHGKNSMLQETVNRLDGIQTRDPMVICNEEH
RFLVAEQLRQINKLSSNIILEPVGRNTAPAIALAALNAVSAGDNPILLVLAADHIMENEA
AFHTAVENAIPHAKAGSLVTFGIIPTGPETGYGYIHRGEQVSGDENAPFRVQRFVEKPDL
KTAEDYLRCGEYYWNSGMFMFHAKRYLQELEKFRPDILEACQAAISSVDKQSDFIKIDKD
CFMNCPDESVDYAVMEKTDDAVVIPLDAGWSDVGSWSALWEVNEKDEQGNSLQGDTFLHN
TQDCYINTDDQLVAAIGVDNLVIVNTKDAVLVANKNEVQDVKRVVEFLKANSRSEYRRHR
ETYWPWGRCDLVVQSDRFNVNRITVKPGESFPLQMHYHRTEHWVILSGTAKVTIQDKTLL
LTENQSTFIPIGSQHTLENPGKIPLELLEIQSGSYLGDDDFIDVANNQ
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgctacttccagtgattatggccggtggaaccggaagccgtttatggccactttctcgt
gaactttaccccaaacaattcatttgcctgcatgggaaaaactccatgctgcaggagacg
gtaaatcgtctcgatggcatccaaacgcgcgacccgatggttatctgcaacgaggaacat
cgattcctggttgcagagcagttgcggcaaatcaacaagctctccagcaacattatcctg
gaacctgtgggccgtaatacggctccagcgattgcgctggcagcgctgaatgcggtttct
gcaggcgataatcccatcctgctggtccttgccgcagaccatattatggaaaatgaagcc
gcctttcatacggcggttgaaaatgcgattcctcatgctaaagcaggcagtttggtcacc
tttggcattatccctacgggcccagagacgggctatggctatattcaccgtggcgaacag
gtgtcgggtgacgaaaatgcgcctttccgcgtgcagcgctttgtagagaaaccggacctc
aaaactgcggaagactatctgcggtgcggcgaatactactggaatagcggcatgtttatg
ttccatgccaagcgctatttacaggaactggagaagttccggcctgatattctggaagcc
tgtcaggctgcaatctccagcgtagataaacaaagcgacttcatcaaaatcgacaaagac
tgcttcatgaactgcccggacgagtccgtggattatgcggtcatggagaagacggatgat
gccgtggttatcccgttggatgccggctggagtgatgtcggctcttggtctgcgctgtgg
gaagtcaatgaaaaagacgaacagggcaactcccttcaaggggataccttcctgcacaac
acacaggattgttacatcaataccgacgatcagctggtggccgccattggcgtggacaac
ctggttattgtcaatacaaaagatgccgtattggttgccaataaaaacgaagttcaggac
gttaaacgcgtcgtggagtttctgaaggcgaatagccgtagtgaatatcgtcgccaccgc
gaaacttactggccttgggggcgttgcgatctggtggttcagagcgaccgttttaacgtt
aatcgcattacggtcaaacccggcgagtccttcccgctgcagatgcactaccaccgcacg
gagcactgggtcattctttcgggaacggcaaaagtgactatccaagataaaacgctgctg
ttaacggaaaaccaatcgacctttattcctattggttcacaacatacgcttgaaaaccca
ggcaaaataccactggaactccttgagattcaatccggttcctacttgggcgacgatgac
tttattgatgtagccaataaccagtaa

DBGET integrated database retrieval system