KEGG   Lonsdalea britannica: CKQ53_11265Help
Entry
CKQ53_11265       CDS       T05623                                 

Definition
(GenBank) histidine ABC transporter permease HisQ
  KO
K10016  histidine transport system permease protein
Organism
lbq  Lonsdalea britannica
Pathway
lbq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lbq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CKQ53_11265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lbq02000]
    CKQ53_11265
Transporters [BR:lbq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    CKQ53_11265
   Histidine transporter
    CKQ53_11265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AXW87503
Position
2473879..2474565
Genome map
AA seq 228 aa AA seqDB search
MLQGYNKLIFEGTLVTIDLALSSVLLAVIIGLLGASGKLSRIRPLVAALNAYTTLIRGVP
DLVLMLLIFYGLQITLNHVTEFLGMSQIDIDPLSAGVITLAFIYGAYFTETFRGAFMAVP
RGQIEAAQAYGFNGMQVFRRVLFPAMMRFALPSIGNNWMIILKATALVSILGLHDVVKAT
QLAGKGTWQPFFYTLMAGAIYLLLTTVSNGVLLWLERRYSMGVKRAEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagggatacaataaattgatcttcgaaggcacgctggtgacgatagacctggcg
ctaagctcggtgctgctggccgtgatcatcggcctcctcggcgcgagcggtaaactctcg
cgcatccgcccgctcgtcgcggcgctgaatgcctacaccacgttaattcgcggggtgccg
gatttggtgctgatgctgctaattttctacgggctgcaaatcacgctcaatcatgtgaca
gagtttctgggtatgagccagattgatatcgacccgctttcggcgggcgtgatcacactg
gcgttcatctacggcgcgtatttcaccgagacgtttcgcggcgcgtttatggccgttccg
cgcggacagatagaggcggcgcaggcgtatggcttcaacggaatgcaggtcttccgccgg
gtgctgttccccgcgatgatgcgttttgcgctgcccagcatcggtaacaactggatgatc
attctgaaagcgacggcgctggtgtccattctggggctgcacgatgtggtcaaagcgacc
cagctggcgggtaaaggcacctggcagccgttcttctataccctgatggccggggccatc
tatctgctgctgaccaccgtctctaatggcgtcttgctgtggctggagcgacgttactct
atgggcgtgaagagggccgaactatga

DBGET integrated database retrieval system