KEGG   Lactobacillus brevis ATCC 367: LVIS_1126
Entry
LVIS_1126         CDS       T00406                                 
Name
(GenBank) hypothetical protein
Organism
lbr  Lactobacillus brevis ATCC 367
SSDB
Motif
Pfam: HNHc_6 SHNi-TPR
Other DBs
NCBI-ProteinID: ABJ64255
UniProt: Q03RB7
Position
complement(1123900..1124601)
AA seq 233 aa
MQLFLPVEEDSNGKLLINLSDVDPPTRRIIAGNVGQLAEIKFDDGRHITIDQRKKIFALL
GEIDQWTGNFTMDITERQMKQLFISEKGLDEEFSFSDCSLKLASEFIEFLIGTCFEYDIP
FAGKTLDAIREQYGWDMFCIKYHRCMICNQPADIAHVHAVGIGRDRNHISHIGNYVMALC
RRHHQEQHRVGIKSFMKENQLKGVKVTPEIAKMLKLGNWQQEQGQNLRFINAE
NT seq 702 nt   +upstreamnt  +downstreamnt
atgcagctatttttgccagtagaagaagattctaacggcaaactgttgattaatctaagc
gatgttgacccgccaactcggcggatcattgctggaaatgtagggcagcttgcggagatt
aagtttgacgatggtcggcacattacgatcgatcagcgtaagaaaatatttgctctactt
ggtgagattgaccagtggactggtaacttcacgatggatattaccgagcggcaaatgaaa
cagctttttatcagtgaaaaaggtttggacgaagaattttcgttcagcgattgttctttg
aagttggccagtgagtttatcgagtttctaatcggtacttgttttgagtatgatattccg
ttcgcaggtaagacattagatgctattcgagagcaatacggctgggatatgttttgcatc
aaatatcatcgttgtatgatctgcaatcagccagccgacatagctcatgtacatgcagtc
ggcattggaagagatcgtaatcacatcagccatattggcaattacgttatggcattgtgt
cgcagacatcatcaagaacaacatcgtgtcggcattaagtcgttcatgaaggagaaccaa
cttaagggagttaaagtcactcctgagattgctaagatgctaaaactaggtaactggcag
caagaacaaggacagaatctaagatttatcaatgcagaatga

DBGET integrated database retrieval system