KEGG   Lactobacillus brevis ATCC 367: LVIS_0889
Entry
LVIS_0889         CDS       T00406                                 

Name
(GenBank) ABC-type antimicrobial peptide transport system, ATPase component
  KO
K02003  putative ABC transport system ATP-binding protein
K02004  putative ABC transport system permease protein
Organism
lbr  Lactobacillus brevis ATCC 367
Brite
KEGG Orthology (KO) [BR:lbr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lbr02000]
    LVIS_0889
Transporters [BR:lbr02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    LVIS_0889
SSDB
Motif
Pfam: ABC_tran FtsX MacB_PCD SMC_N AAA_29 Syntaxin-18_N
Other DBs
NCBI-ProteinID: ABJ64026
UniProt: Q03RZ6
Position
915072..917075
AA seq 667 aa
MATLQLKDIHKSYYLGKEEFPVLKGIDLDFNLGEFVSILGESGGGKSTLMNIIGGLDREF
QGEVQLKGKPIDHRNEKSLDRFRRETIGYIYQAYNLVNHLTVLDNVLISLDMTTLTKEQR
VDRANHLLERVGLAEQAKKYPNQLSGGQKQRVAIARALASDPQIIIADEPTGALDSQNTA
EVLDILNDIAKEGRLVITVTHSQAVADAGTRIVQLVDGKIDSDTSIRQPYPVTGDAERLT
ARKLPARVSYQTAFKHFKFTFGQNFLIMLGTAIGLFAVILFSGLGNGLSGYINEQITNVA
NPQVVSVSRHTRSTSNANKQQTQAESQRAAMGMGTTTAKPKTFSQTQISQIRQLKHVTKV
EKSYSLTDVKIKHGKKSVTTSTASNWTSSATTSSIKVGHKPQAGEIVLDKTAVAKQLNKK
DWKSLIGKTVTVSYSTANANNRPTKVTFKAKVAGIAESSTGAMSITAVNTNTLVKALNKA
NVSTKPAALAVSIDKLGSVNGVVKQINKLKNDGTKLYAATSITSLISTVQTYVHLASSIL
AAIAAISLIVSALMIIVTMYMSVSARTKEIGILRALGESKADIRRLFISESLIIGVLSAV
LATVIALGLGALANTMLSKIASYAFIQITLGNIITTFVIAIVIALIAAYLPARHAASLNP
IDALSAD
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggcgactttacagttaaaggatatccacaagtcctattatttgggtaaggaagaattt
cccgtcttaaagggaattgacttagatttcaacctaggtgaatttgtttctatcttaggt
gaatctggtggtggtaaatccacattaatgaatattattggcggcttggaccgagaattc
caaggtgaagtccagctaaagggtaaacctatcgatcaccgcaatgaaaaatcattggat
cgattccggcgggaaacgattggctacatctaccaagcttacaatttagtcaaccactta
acagtcctcgacaacgtcttgatttcattagacatgacgactttgactaaggaacagcgg
gttgaccgggcaaaccatctgctggaacgcgtcgggttggccgagcaggctaagaaatat
cctaaccaattatctggtggacaaaagcaacgggtcgccattgcgcgggccttggcaagc
gatccccagatcatcattgccgatgaaccaactggtgcgttggattcacaaaatacggct
gaagttctcgacattttaaatgatattgccaaagaaggtcgactggtcattaccgtgacc
cactcacaagccgtggcggatgctgggacccggattgtccagctggtcgacggcaagatc
gacagtgatacctcaatccgacagccttatccagtgactggagatgctgagcgcttaacg
gcccgtaagcttccggcccgggtcagttaccaaaccgccttcaaacattttaagttcact
tttggtcaaaatttcttaatcatgctgggaactgctattggtctgtttgcggtcattctc
ttctcaggattaggcaacggcttgagtggctatatcaacgaacagatcactaatgtggcg
aacccccaagtcgtttccgtttcccgtcatacaaggtcaaccagtaatgccaacaagcag
cagacacaggctgaaagtcagcgggcagcaatggggatgggaaccaccacagccaagccc
aaaacctttagtcagacacaaatcagtcagatcagacagctcaaacatgtgactaaagtc
gaaaaaagctactcactgactgatgttaagatcaagcatggtaagaagtcagtcaccact
agtaccgcatccaactggaccagttctgcaacgacgtcttccatcaaagtcggtcacaaa
cctcaggctggcgagattgtccttgataaaactgcggttgctaaacagctcaataaaaag
gattggaaatcactaattggtaaaaccgttacggttagttattccaccgctaacgcgaat
aatcgacctaccaaggtgacctttaaagccaaagtagcgggtatcgctgaaagttccact
ggggcgatgtcaattacagcggttaacaccaacaccttggtcaaggctctcaacaaggcc
aacgttagtactaagccggccgctctagccgtttctattgataagctggggagtgtcaac
ggtgtggttaagcaaattaataaactcaaaaatgacggcaccaaattatatgccgccaca
tcaattactagtttgattagcaccgttcagacgtatgttcacttagcttcttccattcta
gccgccattgccgccatttccctgattgtctctgcactgatgatcattgtcaccatgtac
atgtccgttagtgcgcggaccaaggaaattgggattttacgcgctttaggtgaaagcaag
gctgatattcggcgcctgttcatcagtgaatccctcattattggtgttctgagtgccgta
ctggcaacggtgattgcattaggcttaggtgcattagctaatacgatgttatctaagatt
gcgtcatatgcctttattcagattacccttggcaatatcatcacaacttttgtgattgcc
atcgtgattgccctcatcgcggcttacttaccagcccgccatgcggcaagtctgaatccg
attgacgcgctaagcgccgattag

DBGET integrated database retrieval system