KEGG   Lactobacillus brevis ATCC 367: LVIS_1408Help
Entry
LVIS_1408         CDS       T00406                                 

Definition
(GenBank) acetoin/pyruvate dehydrogenase complex, E2 component, dihydrolipoamide succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
lbr00010  Glycolysis / Gluconeogenesis
lbr00020  Citrate cycle (TCA cycle)
lbr00620  Pyruvate metabolism
lbr01100  Metabolic pathways
lbr01110  Biosynthesis of secondary metabolites
lbr01120  Microbial metabolism in diverse environments
lbr01130  Biosynthesis of antibiotics
lbr01200  Carbon metabolism
Module
lbr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LVIS_1408
   00020 Citrate cycle (TCA cycle)
    LVIS_1408
   00620 Pyruvate metabolism
    LVIS_1408
Enzymes [BR:lbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LVIS_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H HlyD_D23 RnfC_N NQRA
Motif
Other DBs
NCBI-ProteinID: ABJ64506
UniProt: Q03QL6
Position
complement(1377165..1378484)
Genome map
AA seq 439 aa AA seqDB search
MAYTFKLPELGEGMAEGEISSWLVKEGDAVKEDDTLVEIQNDKSVSELPSPVSGTISKIV
AQEGDTVEIGDPLIVIDDGSDTPADLSKGGEENDAAPAEEAAPAPAEAPAAPAEPAAAPT
GVPAASDPNKLVMAMPSVRQYARDKGVDITQVAPTGNHGQVLKADIDNFNGAAAPAATAS
ATTDAAPAGKAAAGQAIKPWNADNPDLETREPMSPMRKIIAKSMRTSKDIAPHVTSFDEV
EVSALMANRKKYKQAAADRDIHLTFLPYIVKALVAVMKKFPELNASIDDTTQEIVYKHYY
NIGIATNTDDGLYVPNIKAADSKGMFEIAKEITENTQAAYDNKLSPASMAGGSITISNVG
SIGGGWFTPVINQPEVAILGVGRIEKAPYVNEDGDIAVGRMLKLSLSYDHRLIDGALAQN
ALNELKALLHDPEMLLMEG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcttatacgttcaaactcccagagcttggtgaaggaatggccgaaggtgaaatttct
tcatggcttgtaaaagaaggagacgcggttaaggaagacgacacattagtcgaaatccaa
aacgataagtcggtctcggaattaccatcacccgtttcaggtacgatttcaaaaattgtt
gcccaagagggggacactgttgaaattggtgatccactgattgtgattgatgatggatca
gataccccagctgatttaagcaagggtggcgaagaaaatgatgcagcacctgctgaagaa
gcagcaccggcacctgccgaagcgccagcagcacctgctgaaccagcagcggctccaact
ggagttcctgctgcttctgatcccaataaattggttatggcgatgccatcggttcgtcag
tatgcacgtgacaaaggcgttgatattactcaagttgcgccaactgggaatcatgggcaa
gtattgaaagctgacattgacaactttaatggtgcggctgcaccagcggccacggcttca
gcaactactgacgctgcaccggctggtaaggcagctgcaggtcaagcaatcaaaccttgg
aacgctgataaccctgatttggaaactcgtgaaccaatgtcaccaatgcggaagatcatt
gccaagagcatgcggacttctaaagacattgcgccacacgtaacgtcctttgacgaagtc
gaagtttcagctttaatggctaaccgtaagaagtacaagcaagccgctgcagatcgcgac
attcacctgactttcttaccttacattgttaaggctttggttgctgttatgaagaagttc
cctgaactaaatgcttctattgatgacactacccaagagattgtctacaagcactactac
aacattgggattgctaccaatactgatgatggcttgtatgtgccaaatatcaaagcagca
gattctaagggtatgtttgaaattgccaaggaaatcactgaaaatacgcaagccgcttac
gataacaagttaagccctgcttccatggccggtggttccatcacgatttctaacgttggt
tctattggtggtggctggttcacaccagttatcaaccaacctgaagttgctattttaggg
gttggccggattgaaaaggctccttatgttaatgaagatggcgacattgctgttggccgg
atgttgaagctttccttgagttacgaccaccgtttgattgatggtgccttagctcagaat
gctttgaatgaattaaaggccttgctgcatgatccagaaatgttgttaatggaagggtag

DBGET integrated database retrieval system