KEGG   Lactobacillus brevis ATCC 367: LVIS_1446Help
Entry
LVIS_1446         CDS       T00406                                 

Definition
(GenBank) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
lbr  Lactobacillus brevis ATCC 367
Brite
KEGG Orthology (KO) [BR:lbr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lbr03036]
    LVIS_1446
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lbr04812]
    LVIS_1446
   02048 Prokaryotic Defense System [BR:lbr02048]
    LVIS_1446
Chromosome and associated proteins [BR:lbr03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    LVIS_1446
Cytoskeleton proteins [BR:lbr04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   LVIS_1446
Prokaryotic defense system [BR:lbr02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    LVIS_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ABJ64544
UniProt: Q03QH8
Position
complement(1417848..1419107)
Genome map
AA seq 419 aa AA seqDB search
MEYSLDSAQNNGAIIKVIGVGGGGNNAVNRMIAEDVKGVEFIVANTDVQALEASKAETKI
QLGPKLTKGLGAGANPEVGAKAAEESEEAITEALDGADMVFVTAGMGGGTGNGAAPIVAK
IAKESGALTVGVVTRPFSFEGPRRGRFAAEGVAQMKENVDTLIVIANNRLLEIVDKKTPM
MEAFQEADNVLRQGVQGISDLITSPGYVNLDFADVKTVMKDQGAALMGIGSANGENRTED
ATKKAISSPLLEVSIDGAEQVLLNITGGPDLSLFEAQAASQIVSDAATSDVNIIFGTSID
EDLGDEVRVTVIATGIDKKKEEREAAHSRVARRAESQNRADNATETPAKETEKDPFGNWD
IREPAHRPEPTSSAANTNNEFAGVDKPDFNIFNPNQNDSSASDDNKSEDTPPFFKRRRK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggaatactcattagattctgcgcagaacaatggcgcaatcattaaagttatcggtgtc
ggtggcggtggaaacaatgcggttaaccggatgatcgcggaagacgttaagggtgtcgag
tttatcgtcgctaacaccgatgttcaagcacttgaggcctcaaaagccgaaaccaagatt
caattaggaccgaaattaacgaaaggacttggcgcgggtgccaatccagaagttggtgcc
aaggcagctgaagaaagcgaagaagcaattaccgaagccttggatggtgccgatatggtc
ttcgttactgccggaatgggtgggggtactggtaacggtgccgcaccgatcgtggctaag
attgccaaggaaagcggcgcgttaactgttggtgtcgtgacccgaccatttagttttgaa
ggcccacggcggggacggttcgctgctgaaggggttgcccaaatgaaggaaaacgttgat
acgttgatcgtcattgctaacaaccgcttattggaaattgttgacaagaagacgccaatg
atggaagccttccaagaagctgacaatgttttacgtcaaggggttcaaggcatctctgac
ttgatcacgagtcctggctacgttaacttggactttgctgatgttaaaacggttatgaag
gatcaaggtgcggccttaatgggaattgggtctgctaatggtgaaaaccggacagaagac
gcaaccaagaaggctatctcatcaccacttctggaagtgtcaattgatggggctgaacag
gtcctgttgaacatcactggtggtcccgacttgtccttgttcgaagcacaagcggcctca
caaattgtgtccgatgcggctacgagtgacgttaacattatcttcgggacatcaattgat
gaagatctgggcgatgaagttcgggttacggttattgccacaggaattgataagaaaaaa
gaagaacgcgaagcggctcacagtcgcgtagcacgacgggctgaaagccaaaaccgggct
gataatgcaaccgaaacaccagcaaaggaaaccgaaaaggatccattcggaaactgggac
attcgtgaaccagctcatcgaccagaaccaactagttcggcggctaacaccaataacgaa
ttcgctggggttgataaaccagattttaatattttcaatccgaaccagaatgatagctcg
gcttcagatgataacaagagtgaagatacaccaccatttttcaaacggcggcgtaagtaa

DBGET integrated database retrieval system