KEGG   Lactobacillus brevis ATCC 367: LVIS_2218Help
Entry
LVIS_2218         CDS       T00406                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
lbr00071  Fatty acid degradation
lbr00072  Synthesis and degradation of ketone bodies
lbr00280  Valine, leucine and isoleucine degradation
lbr00310  Lysine degradation
lbr00362  Benzoate degradation
lbr00380  Tryptophan metabolism
lbr00620  Pyruvate metabolism
lbr00630  Glyoxylate and dicarboxylate metabolism
lbr00640  Propanoate metabolism
lbr00650  Butanoate metabolism
lbr00900  Terpenoid backbone biosynthesis
lbr01100  Metabolic pathways
lbr01110  Biosynthesis of secondary metabolites
lbr01120  Microbial metabolism in diverse environments
lbr01130  Biosynthesis of antibiotics
lbr01200  Carbon metabolism
lbr01212  Fatty acid metabolism
lbr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LVIS_2218
   00630 Glyoxylate and dicarboxylate metabolism
    LVIS_2218
   00640 Propanoate metabolism
    LVIS_2218
   00650 Butanoate metabolism
    LVIS_2218
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LVIS_2218
   00072 Synthesis and degradation of ketone bodies
    LVIS_2218
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LVIS_2218
   00310 Lysine degradation
    LVIS_2218
   00380 Tryptophan metabolism
    LVIS_2218
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LVIS_2218
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LVIS_2218
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LVIS_2218
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lbr04147]
    LVIS_2218
Enzymes [BR:lbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LVIS_2218
Exosome [BR:lbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LVIS_2218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III PsbW
Motif
Other DBs
NCBI-ProteinID: ABJ65268
UniProt: Q03NF4
Position
2185363..2186532
Genome map
AA seq 389 aa AA seqDB search
MAEEVVIVSAARTPIGKFGKSLRGLSAEQLGTIAAKAAITRSGLDPATIQQTIFGSVLQA
GQGQNIARQIELNAGLPVTSTAMTINQVCGSSLKAIRLGQSAILMGDADIVLVGGTESMS
NAPYLTPQTRWGHKFGDITLTDSLAHDGLTDAFTDIPMGITAENVAAQFHISRADQDAFA
LRSQRRATAAQQANRFADEIVPVSLGTTTLTTDEAVRTTTSREQLAALRPAFKSVGTVTA
GNAAGLNDGAAAMILMKKSTARAAGIAYLATLRGYQEVGIDPAIMGYAPVTAIQQLLTKT
QRSVSDIDRFELNEAFAAQSVAVGQALALPDDRLNVNGGAIALGHPLGASGTRIVVTLLY
ELLHSGTHLGVASMCIGGGMGMALMIESN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaagttgttattgtcagtgcggcacgcacccccattggcaaatttggtaaa
agtttaaggggcttaagcgccgagcaattaggtactatcgctgccaaagccgcgattacc
cgcagtgggttagaccccgccacaattcagcagaccatctttggttcagtcttacaggct
ggtcaagggcaaaacattgcccgacaaattgaacttaacgctggtcttcccgtcactagc
accgcgatgaccattaatcaggtttgtggctccagcctaaaagccatccgtttgggccaa
agcgccatcctcatgggtgatgccgacattgttctagtcggtggcaccgaaagcatgagc
aatgccccttatctcacgccgcaaacacgttggggtcataaatttggtgatattacgctc
actgatagtctagcccatgacggcttgaccgacgccttcaccgacatccccatggggatc
accgctgaaaacgttgcagctcaatttcatattagccgtgctgatcaagatgctttcgca
cttcgttcccaacggcgtgcaaccgctgcacaacaagccaatcgttttgccgacgagatc
gttcccgtctccttaggcaccaccacgttaacgaccgatgaagccgtgcgcaccacaact
tcacgcgaacaacttgccgcactccggcccgcttttaaatccgttggcaccgttactgcc
ggcaatgccgctggcttaaacgatggggccgctgccatgattctcatgaaaaaatcaacc
gcccgagccgccggtattgcgtatctcgcaacgctccgtggctaccaagaagtcggcatt
gacccggccatcatgggctacgcccccgtcacagcaatccaacaactcttaaccaaaacc
cagcgatccgtcagtgacattgatcgttttgaattaaatgaagcctttgccgcccaatcc
gtcgcggttggtcaggcactggcacttcctgatgaccgcctaaacgttaatggcggggcc
attgctttgggtcatccactaggtgcttctgggacccgcattgtagtcaccttactctat
gaactcctgcacagtggcactcacttaggtgtcgcctcaatgtgtattggcggtggcatg
gggatggcgctgatgattgaatccaactaa

DBGET integrated database retrieval system