KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_0297Help
Entry
LBUL_0297         CDS       T00419                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
lbu00450  Selenocompound metabolism
lbu00970  Aminoacyl-tRNA biosynthesis
lbu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LBUL_0297
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LBUL_0297
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lbu01007]
    LBUL_0297
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lbu03016]
    LBUL_0297
Enzymes [BR:lbu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LBUL_0297
Amino acid related enzymes [BR:lbu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LBUL_0297
Transfer RNA biogenesis [BR:lbu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LBUL_0297
 Prokaryotic type
   Other AARSs
    LBUL_0297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f rRNA_methylase
Motif
Other DBs
NCBI-ProteinID: ABJ57959
Position
284540..286522
Genome map
AA seq 660 aa AA seqDB search
MADNKKTFYITTPIYYPSGRLTIGNAYTTVAADTMTRYKKARGYDTFFLTGTDEHGLKIE
QKAEKLGMKPKAYLDGMVKDIKELWKKLDINYDKFIRTTDEEHVKAVQKIFEKLKASGDI
YLGEYTGWYSVEDEEYFTESQLKEVFKDDQGNVVGGIAPSGHEVQLVKEPSYFFKMSKYA
DRLLQYYKDHPEFIQPNSREKEMVNNFIKPGLEDLSVTRTTVDWGIPVPSDPKHVVYVWI
DALANYITALGYGSEDDSLFKKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVFG
HGWVLIYKDKMSKSKGNAVYPESLISRYGLDPVRYYLMRAIPFGADGSFTPEDFVERTNF
DLANDLGNLLNRTVSMINQYQKGLVAPVDQEQDKYGQDLAAVAAKAISDYYGNMDKMHFS
NALENVWQLISRANKYIDETTPWVLNKEGKTEELSRVMSNLAESLRLVAIMIAPVMTETP
GKMFAQLGLDWEDESQKDLQFGGFAWDVNVVAKPTPIFPRLKNDEEVAYIKEEMKKAKPK
KQSRREQKQEEKQITIDDFAKVKIQVGKILSVEPVKGSSKLLMFKLDFGKTGERQILSGI
RKFYPDESILLGKKVLAVTNLKPRKMLGHESQGMLLSSEADGDVKLALVGDEHPVGAELG
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggcagataacaagaaaactttttacattaccacgccaatctactatccgtctggccgt
ttgaccatcggcaacgcctacacgacggtagcagcggacaccatgacccgctacaagaag
gctcgcggctatgacaccttcttcttgaccgggaccgacgaacacggcttgaagatcgaa
caaaaggccgaaaagctgggcatgaagccaaaggcttatctggacggcatggtcaaggac
atcaaggaactgtggaagaagctggacatcaactacgacaagttcatccggaccactgat
gaagaacatgtcaaggctgtccagaagatttttgaaaagctgaaggcctcaggtgacatc
tacctgggtgaatacaccggctggtactcagttgaagacgaagaatacttcactgaatcc
cagctgaaggaagtcttcaaagacgaccagggcaacgttgtcggcgggatcgccccatct
ggccacgaagttcaattggtcaaggaaccatcctacttcttcaagatgagcaagtacgct
gaccggcttctccagtactacaaggaccacccggaattcatccaaccaaactcccgggaa
aaggaaatggtgaacaacttcatcaagccgggcctggaagacttgtcagttacccggacc
acggttgactgggggatcccggtgccaagcgacccgaagcacgttgtttacgtttggatc
gacgccttggccaactatatcactgcattgggctatgggtcagaagatgactcccttttc
aagaagtactggccagctgacgtccacctggtcggcaaggaaatcgtccgtttccacacc
atttactggccaatcatgctgatggccctggacttgccgctgcctaagcaggtcttcggc
cacggctgggtcttgatctacaaggacaagatgtccaagtccaagggtaacgccgtttac
ccggaatccttgatttcccgctacggcctggacccggtccgctactacctgatgcgggcc
atcccatttggggctgacggttcctttaccccggaagacttcgttgaacggaccaatttt
gacctggccaacgacctgggcaacctcttgaaccggactgtttccatgatcaaccagtac
caaaaaggcctggttgccccggttgaccaggaacaggacaagtacggccaagacctggct
gccgttgctgccaaggccatcagcgactactacggcaacatggacaagatgcacttctcc
aacgctttggaaaatgtctggcagctgatttcccgggccaacaagtacatcgatgaaact
accccatgggttttgaacaaggaaggcaagactgaagaactttccagagtcatgagcaac
ctggcggaaagcctgcgcctggtagccatcatgatcgctccggttatgaccgaaactcca
ggcaagatgtttgcccagctgggcctggactgggaagacgaaagccagaaggacttgcag
ttcggcggctttgcctgggacgtaaacgtcgttgccaagccaactccaatcttcccacgc
ttgaagaatgacgaagaagtggcctacatcaaggaagaaatgaagaaggccaagccaaag
aaacagtcaagaagagaacaaaagcaggaagaaaagcagatcacgatcgacgactttgcc
aaggtcaagatccaggtcggcaagatcctgtccgttgaaccagtcaagggatcaagcaag
ctcttgatgttcaagctagacttcggcaagaccggcgagcggcagatcttgagcgggatc
cgcaagttctacccagatgaaagcatccttttgggcaagaaggttctggctgtaaccaac
ttgaagccgcgcaagatgctgggccacgaaagccagggcatgcttttgtccagcgaagct
gacggcgatgtcaagctggccctggtcggcgacgaacacccggtaggggctgaactgggc
taa

DBGET integrated database retrieval system