KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_0721Help
Entry
LBUL_0721         CDS       T00419                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
lbu00670  One carbon pool by folate
lbu00790  Folate biosynthesis
lbu01100  Metabolic pathways
Module
lbu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LBUL_0721
   00670 One carbon pool by folate
    LBUL_0721
Enzymes [BR:lbu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LBUL_0721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ABJ58344
Position
673411..673899
Genome map
AA seq 162 aa AA seqDB search
MLSYVWAEDEKGAIGYQGRLPWHLPADLAHFKAKTMGHPMLMGRKTFESLPGLLPGRQHV
VLSTRKLDLPAGVLQLKSEEEVSAWLKEQAGEVCVIGGSSLFALLADQVDKLEVTRIKGI
FSADTYMPNLDWAAFALVKSEAHRADGKNKYDYVFETYLRKK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcttagctacgtttgggcagaagatgaaaaaggcgccattggctaccagggccgcctg
ccctggcacctgccggcagatttagcccattttaaggcaaaaaccatgggccaccccatg
ctgatgggaagaaagacttttgagtccttgccgggcctgttgcctggccggcagcatgtc
gtcctttccaccaggaaattagacctgccagctggggttctgcagctgaaaagcgaagaa
gaagtttccgcctggctgaaggagcaggcgggggaagtctgcgttattggcggctccagc
ctctttgccctgctggctgaccaggttgacaagctggaagtgacccggatcaagggaatt
ttttccgctgacacctacatgccaaaccttgactgggcggcttttgccctggtaaagagt
gaagcccaccgggcagacggcaagaataagtatgactatgtctttgagacttacctgcgt
aaaaaatag

DBGET integrated database retrieval system