KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_0804Help
Entry
LBUL_0804         CDS       T00419                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
lbu00071  Fatty acid degradation
lbu00072  Synthesis and degradation of ketone bodies
lbu00280  Valine, leucine and isoleucine degradation
lbu00362  Benzoate degradation
lbu00620  Pyruvate metabolism
lbu00630  Glyoxylate and dicarboxylate metabolism
lbu00640  Propanoate metabolism
lbu00650  Butanoate metabolism
lbu00900  Terpenoid backbone biosynthesis
lbu01100  Metabolic pathways
lbu01110  Biosynthesis of secondary metabolites
lbu01120  Microbial metabolism in diverse environments
lbu01130  Biosynthesis of antibiotics
lbu01200  Carbon metabolism
lbu01212  Fatty acid metabolism
lbu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lbu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBUL_0804
   00630 Glyoxylate and dicarboxylate metabolism
    LBUL_0804
   00640 Propanoate metabolism
    LBUL_0804
   00650 Butanoate metabolism
    LBUL_0804
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LBUL_0804
   00072 Synthesis and degradation of ketone bodies
    LBUL_0804
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBUL_0804
   00310 Lysine degradation
    LBUL_0804
   00380 Tryptophan metabolism
    LBUL_0804
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBUL_0804
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LBUL_0804
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LBUL_0804
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lbu04147]
    LBUL_0804
Enzymes [BR:lbu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LBUL_0804
Exosome [BR:lbu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBUL_0804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABJ58410
Position
760418..761518
Genome map
AA seq 366 aa AA seqDB search
MQDIYIVAAKRTPFGRYHKQLADFSAIDLGQIALRGALKEAGLDAESLDALFMGNVLSAG
LGQNMARQIALNAGMRQDSVAVSINEVCGSSLKAARLAEAQMLIGDLGLVAVGGSESMTN
ASKEIMFSDGLVDSFSGKSMGITAENVAKRNHISRQDADAFSLSSHQKAVKAQAEGLFAD
EIIQIEDLKQDENVRPDTSLEALAGLKTSFLEDGTVTAGNASPISDGASMIILATAEKVA
EYQLTPLAKLGAYAEVGYDPEFMGYGPYYAIRKLLNETGRQVADYDFFEINEAFAATTLA
VARDLEIPLAKVNKQGGAIALGHPLGASGTRLLATAARQLQRGGQRAIASLCIGGGLAIA
FEIEKA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatatttatattgttgcggccaagcgaactccatttggccgttaccacaagcaa
ttggctgacttttctgctatcgacctgggccaaatcgccctgcgcggcgcattaaaagaa
gccggccttgacgccgaatccctggatgccctcttcatgggcaatgtcctgtctgccggc
ttaggccaaaacatggcccggcaaattgctttaaacgccgggatgcggcaggactcagtc
gccgtgtccatcaacgaagtctgcggctccagcctcaaggctgcccggctggctgaagcc
caaatgttaatcggtgacctgggcctggttgctgtcggcggcagcgaaagcatgaccaac
gcctcaaaggaaatcatgttcagcgatggtctcgttgactccttctccggtaaatccatg
ggcattactgccgaaaacgtggctaagcgcaaccacatcagccgccaagacgctgacgcc
ttcagcttgtcctcccaccaaaaagctgtcaaagcacaagctgaaggactttttgccgat
gaaatcattcaaattgaagatctcaagcaagatgaaaacgttcgcccggataccagcctg
gaagccctggctggtcttaaaacttccttccttgaagacgggaccgtcactgccggtaac
gcctccccaatctccgacggggccagcatgatcatcctggctaccgcggaaaaagtcgct
gaataccagctgacgcctttagccaagctgggtgcttacgccgaagtaggctatgacccg
gaattcatgggttatggtccatactatgctatccgtaagctgcttaatgaaactggccgg
caggtagccgattacgacttctttgaaatcaatgaagcctttgccgcaactactttggct
gttgcccgcgacctggaaattcctttagccaaggtcaacaagcagggcggggcgatcgct
ttaggccacccgctcggcgcttccggcacccgccttctggctaccgctgcccgccagctg
caaagaggcggccagcgcgctatcgccagcctttgcatcggaggcggcctggccatcgct
tttgaaattgagaaggcataa

DBGET integrated database retrieval system