KEGG   Lachnospiraceae bacterium oral taxon 500: C3V36_02765Help
Entry
C3V36_02765       CDS       T05749                                 

Definition
(GenBank) ketose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lbw  Lachnospiraceae bacterium oral taxon 500
Pathway
lbw00010  Glycolysis / Gluconeogenesis
lbw00030  Pentose phosphate pathway
lbw00051  Fructose and mannose metabolism
lbw00680  Methane metabolism
lbw01100  Metabolic pathways
lbw01110  Biosynthesis of secondary metabolites
lbw01120  Microbial metabolism in diverse environments
lbw01130  Biosynthesis of antibiotics
lbw01200  Carbon metabolism
lbw01230  Biosynthesis of amino acids
Module
lbw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lbw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C3V36_02765
   00030 Pentose phosphate pathway
    C3V36_02765
   00051 Fructose and mannose metabolism
    C3V36_02765
  09102 Energy metabolism
   00680 Methane metabolism
    C3V36_02765
Enzymes [BR:lbw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     C3V36_02765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase G3P_antiterm DUF2164 Anemone_cytotox
Motif
Other DBs
NCBI-ProteinID: AVM68270
UniProt: A0A2R3MXB5
Position
complement(582173..583033)
Genome map
AA seq 286 aa AA seqDB search
MLISMKQLLETAQSKKFAVGAFNICDSLLFETVLRCAEKEEAPVIIQLAPPEFEYVGESF
FRYMIAEMEKSKVPCTLHLDHGKTMSDCVKAIRCGFTSIMIDGSELEYEENIRITQKVCE
IAHCVGVSVEAEIGTIGSLESSVEGGASDIIYTVPEQTVDFIEKTKVDALAVAIGTAHGI
YPPGFVPKLRIDILKEIKEMIKTPLVLHGGSSNKDEEIVEACQHGICKVNIASDYRKAFF
EGAKQKLIRTNAFWTPNVYDEAIMDAQKVIAHKMELFGCIGKMNLY
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatcagtatgaaacaattattagaaactgcccagagcaaaaaatttgctgtagga
gcatttaatatttgtgacagtcttttatttgaaacggtattgcgttgtgccgaaaaagag
gaagcgccggtcattattcagctggcgccgccggagtttgaatatgtaggagaatctttt
tttcgttatatgattgcggaaatggaaaagtcaaaagtgccttgcacattgcatttggat
catgggaaaacaatgtcagattgtgtaaaagcaatacgctgcggctttacatcgattatg
attgatggttcagagttagagtatgaagaaaacattaggattactcaaaaggtttgtgaa
atagcgcattgtgtaggtgtttcagtagaagcggaaatcggtaccattggttcgttagaa
tccagtgttgaaggaggggcatctgacattatatacacagtgccggaacagacggtagat
tttattgagaaaaccaaggtagatgctttagcggtggcgattggaacagcacatgggata
tatccgcctggatttgttccaaaacttcgaattgatattttgaaagaaattaaggagatg
ataaaaactccattagttttacatggcggttcgtcaaacaaagatgaagaaatagtagaa
gcatgtcaacatggaatttgtaaggtaaatattgcaagtgattaccgcaaagcatttttt
gagggggcaaaacagaaattaatcagaacaaatgctttctggacaccaaatgtatatgat
gaggcaataatggatgcccaaaaagtgattgcacataaaatggaacttttcggctgtatc
ggtaaaatgaacttgtattaa

DBGET integrated database retrieval system