KEGG   Lachnospiraceae bacterium oral taxon 500: C3V36_06225Help
Entry
C3V36_06225       CDS       T05749                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
lbw  Lachnospiraceae bacterium oral taxon 500
Pathway
lbw00520  Amino sugar and nucleotide sugar metabolism
lbw01100  Metabolic pathways
lbw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lbw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C3V36_06225 (nagA)
Enzymes [BR:lbw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     C3V36_06225 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AVM68867
UniProt: A0A2R3MZA8
Position
1360379..1361521
Genome map
AA seq 380 aa AA seqDB search
MKAVINGKVYLDSHFAEDKVILFEETIQQIIDRADWDGKADQIIDAGGAYVTPGFVDVHI
HGFNGADVMDGKTESLSVMAKGLTANGVTSFLATTMTMGVPLIRSALAAVRKYTEDAALS
RQGAEIVGVHLEGPFINPKKKGAQRGEDIIPADIRVIEGYEDLVKVITIAPEMPDNMAFI
EKYADRFCFSIGHTDADYDTAKTAVQKGAKGMTHLFNAMTPLQHRAPGVVTAGLTEDIYT
ELIADTIHVHKGIFELIYKQKGVSRLILITDAMRGAGMAEGNYDLGGQEVIIKDGRCLLI
DGTLAGSVLKLNDAVRNFSESTTIGLEKVIPLATLTPATYIGVQDRKGSLEVGKDADIVL
LDDKIKVLKTIARGEVKYEA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtcattaacggaaaagtttatcttgactcgcattttgcggaagataaggtc
attctttttgaggaaacgattcagcaaattatcgaccgggcggactgggacggcaaggcg
gatcagattattgatgcgggcggtgcatatgtcacgccgggctttgtcgatgtccatatt
cacggctttaacggcgcggacgtaatggacgggaaaacagaatcgctgagcgtcatggcc
aaggggctgacggccaacggcgtgacttcttttttggcgacgaccatgaccatgggcgtg
ccgctgattcgcagtgctttggcggcggtcagaaaatatactgaggacgccgctttgtcc
cggcagggagcggagattgtgggcgtgcatttggaagggccatttatcaaccctaagaaa
aaaggcgcgcagcggggcgaggacattattccggcggatattcgggtaattgagggttat
gaggatttggtcaaggtcattaccattgcgccggaaatgccggataatatggcttttatt
gaaaaatacgccgatcggttctgcttttcgatcggtcataccgatgccgattatgatact
gccaaaacagccgtgcaaaagggcgcgaaagggatgacgcatttatttaacgctatgact
ccgctccagcaccgtgcacccggcgtggtgacggcagggctgacggaagacatttatacg
gaactgattgccgatacgattcatgttcataagggaatttttgaactgatttataagcaa
aagggcgtaagccgcctgattttgattaccgatgccatgcgcggtgcggggatggccgag
ggcaattatgatttgggcggacaagaggttattattaaggacgggcgctgccttttgatt
gatggtactttggccggcagcgtgctgaagctgaatgatgcagttcgcaatttcagtgaa
agtacgaccatcggtttagaaaaagtgattccgctggcgacgttgacaccggccacttat
atcggtgtgcaggatcgcaaggggagtttggaagtcgggaaagacgccgatatcgtgctg
ctagatgataaaatcaaagtattaaagacaattgccagaggagaagtgaagtatgaagct
taa

DBGET integrated database retrieval system