KEGG   Lachnospiraceae bacterium oral taxon 500: C3V36_06270Help
Entry
C3V36_06270       CDS       T05749                                 

Definition
(GenBank) bifunctional metallophosphatase/5'-nucleotidase
  KO
K11751  5'-nucleotidase / UDP-sugar diphosphatase [EC:3.1.3.5 3.6.1.45]
Organism
lbw  Lachnospiraceae bacterium oral taxon 500
Pathway
lbw00230  Purine metabolism
lbw00240  Pyrimidine metabolism
lbw00760  Nicotinate and nicotinamide metabolism
lbw01100  Metabolic pathways
lbw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C3V36_06270
   00240 Pyrimidine metabolism
    C3V36_06270
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    C3V36_06270
Enzymes [BR:lbw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     C3V36_06270
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     C3V36_06270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos PGA_cap
Motif
Other DBs
NCBI-ProteinID: AVM68875
UniProt: A0A2R3MZ05
Position
complement(1371519..1372991)
Genome map
AA seq 490 aa AA seqDB search
MSSAPHLKKLTLLHSNDLHGDFLAEQVDDKLVGGVSMLSGYINQVRQSEQNVIYAIAGDM
FRGSIIDSEYKGISTIEIMNALAPDIVTIGNHELDYGIPHLLFIEKCAQFPIINANLFIK
TNHARLFSPYYIMEIDGMKILFIGIITNAVLAQAKQDHLIGSFIGIEEAAQEVGRICNTY
NRIDIDFTVLLTHIGFEADKELAALLRPEWGVDLIIGGHSHTLMDQPYTVAGIPIAQAGV
GTDQIGRFDIIVNTDTNSIESYQWQCIPIDNRHCPVDEQMEHLIRKYKDVTDQKYARIVT
RFSRPLTHPQRNTETALGNLFADIFKNSLGVDIMLLGSGSIRGTKLGPIVEYGGLAEIFP
YDDGVYMLKVDGRTFRQMMLYMLRDDAFLDKTEFYQLSHELKLTYSRSRKEIVSLTYQGK
EMANDDIFTVGLQNYHYCNLESFFGVSFDHIKTFAIPKVISTSCLDILEEYLSSHKAIRQ
DVEGRVTILD
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgcaccgcatttaaaaaaattaacactgcttcattccaatgatttgcatggt
gattttttagccgaacaggttgatgacaaactggttggcggtgtttctatgctgtccggc
tatatcaatcaagtccggcaatcggagcaaaatgtaatctatgccattgccggggatatg
ttccgcggctcaatcattgactccgaatacaaaggaatttctaccattgaaattatgaac
gccttagcacccgacattgttaccatcggcaaccatgaactggattacggcatcccgcat
ttgctttttattgaaaaatgtgcccagtttccgattatcaacgccaatctgtttatcaaa
accaatcatgcccgcctgttttcgccttattacatcatggaaatcgacggcatgaaaatc
ctttttatcggcatcatcactaacgccgttttagcacaggccaaacaggatcacctgatc
ggctcctttatcggaattgaagaagcggcacaggaagtcggccgaatctgcaacacctat
aatcgaatcgacattgattttaccgttctcttaactcatatcggctttgaggccgataag
gagctggctgcactactgcggccggaatggggcgttgatttgattatcggcggccactcc
cataccttaatggatcagccctatactgttgccggtatcccgattgcccaggccggggtc
ggtaccgaccaaatcgggcggtttgacatcattgtcaacaccgataccaacagcattgaa
agctaccagtggcagtgcattccgattgacaaccggcactgtccggtagacgaacagatg
gaacacctgattcgcaaatacaaggatgtaaccgaccagaaatacgcccgcattgtcacc
cgtttcagccgtcctttaacgcatccgcagcgcaataccgaaacggcgctgggaaatctg
tttgccgatatttttaaaaacagcctgggcgtagacattatgctgctcggttccggcagc
atccgcggcacaaagttaggtccgattgttgaatacggcggtttagccgagattttcccc
tatgacgacggtgtttatatgctgaaagtggacggccgaaccttccgccaaatgatgctt
tatatgctgcgcgacgatgcttttttggacaagactgagttttatcagttatcgcatgaa
ttaaagctcacctattcccgttcccgcaaggaaatagtcagcctgacttatcagggcaag
gaaatggctaatgatgacattttcacggttggtctgcaaaattatcattattgcaatttg
gaaagcttttttggcgtcagttttgatcatatcaaaacttttgctatccccaaggtaatt
tccacttcctgtctggatatcctggaggaatatttaagctctcacaaagcgatccgtcag
gatgttgaaggccgggtaactattttggattaa

DBGET integrated database retrieval system