KEGG   Leadbetterella byssophila: Lbys_0690Help
Entry
Lbys_0690         CDS       T01350                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
lby  Leadbetterella byssophila
Pathway
lby00790  Folate biosynthesis
lby01100  Metabolic pathways
Module
lby_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Lbys_0690
Enzymes [BR:lby01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Lbys_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ADQ16452
UniProt: E4RZB3
Position
complement(760533..761198)
Genome map
AA seq 221 aa AA seqDB search
MLNILKTEDEIGNDHQMTSAKTPLRPDAFELSDEEKIEKIAVHFREIMHTLGLDLNDESL
AGTPRRVAKMYVQELFSGLRPDNMPSVTLFENNYKFSEILVERDITFYSNCEHHFVPIVG
KVHIGYISTGKVIGLSKLHRIVNYFSRRPQVQERLTIQIGETLTRVLATEDVAVVVDADH
FCVSSRGIADQSSSTVTSFFSGAFHDSAKKEEFLQLVKLRA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatatcctgaaaactgaagacgaaatcgggaatgaccaccagatgacttcagcg
aagactccccttcgtccggatgcctttgaactaagtgacgaagaaaagattgagaagata
gctgtgcacttcagagaaatcatgcacaccctaggtttggacctaaatgacgaaagtctt
gcaggtacgcctagacgcgtggctaaaatgtatgtgcaggaattgttctccggtttacgt
ccggacaatatgccttctgtgactctgtttgaaaacaactataaattctcagagatactt
gtagaaagggatatcactttctactccaactgcgaacaccatttcgtccccatcgtagga
aaagtacatatcggctatatttctacaggaaaggttataggcttatccaaattacatcgt
atagttaattatttctccagaagacctcaggtacaagaacgcttgaccatacagattgga
gaaacattaacccgggtactagctacagaagatgtggcagtggtagttgatgctgatcat
ttttgtgtatcctccagaggaatagctgaccaaagcagttctaccgtaacttcattcttt
agcggagcctttcatgatagtgcgaagaaagaagagttcttacaattggtaaaattaaga
gcctaa

DBGET integrated database retrieval system