KEGG   Leadbetterella byssophila: Lbys_1247Help
Entry
Lbys_1247         CDS       T01350                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lby  Leadbetterella byssophila
Pathway
lby00480  Glutathione metabolism
lby00590  Arachidonic acid metabolism
lby01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lby00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Lbys_1247
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Lbys_1247
Enzymes [BR:lby01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Lbys_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADQ16967
UniProt: E4RUU4
Position
1290476..1291084
Genome map
AA seq 202 aa AA seqDB search
MMKTWLIVIVSGAVAALVLSNIGLIKNIFSAKNGISTMEENFTHKGSFYDFTVDDLEGNP
VDLSVYKGKKVVIINTASKCGFTPQYAEWQKFHEKYGDKIAVLGFPANNFMSQEPGSNEE
IAEFCQRNYGVTFKMFSKVDVKGKDKAPLYRWLSEKDLNGWNDKEPTWNFCKYVVDENGN
LTHFFESKITPDNEQFRKAVGV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaacctggttaatcgtaattgtatccggagcggtagccgccttggtactaagt
aatattggtttgataaagaatatcttttctgcgaagaacggtataagcactatggaagaa
aattttacacacaaaggatccttttatgactttacagtagatgatcttgagggtaatcct
gtagatctgtctgtttacaaaggcaaaaaagtggttatcatcaacactgcttcgaaatgc
ggttttactccacaatatgcagagtggcagaaatttcatgaaaagtatggagataaaatt
gccgtcttgggctttcctgctaataattttatgagccaagaacccggaagtaacgaggaa
attgcagaattttgccagagaaattatggcgttactttcaagatgttctctaaagtagac
gtaaaaggaaaagataaggcacctctctatcgctggttaagtgaaaaggacttaaacgga
tggaacgataaagaacctacctggaacttttgcaaatacgtggtggacgaaaacggcaac
ttaacgcacttttttgaatcaaagataactccggataatgagcaattccggaaggctgta
ggagtttaa

DBGET integrated database retrieval system