KEGG   Leadbetterella byssophila: Lbys_1431Help
Entry
Lbys_1431         CDS       T01350                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
lby  Leadbetterella byssophila
Pathway
lby00260  Glycine, serine and threonine metabolism
lby01100  Metabolic pathways
lby01110  Biosynthesis of secondary metabolites
lby01120  Microbial metabolism in diverse environments
lby01130  Biosynthesis of antibiotics
lby01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lby00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lbys_1431
Enzymes [BR:lby01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Lbys_1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADQ17145
UniProt: E4RWB0
Position
complement(1479234..1480280)
Genome map
AA seq 348 aa AA seqDB search
MGVFFMIKFLNDYSEGAHPLILQRLAETNLDQQSGYGTDSYSEAARQYIRSAMKRPDADV
YFVSGGTQANLLVIAALLKPFESVIAVESGHINTHETGAIEATGHKIEYVLGKEGKLTPE
LIAPVLVKSPKYHTVKPRMVYISNTTELGTVYSKAELQALSEYCKANDLLLFMDGARLAM
ALASKFNDLTLEDIASYCDVFYIGGTKNGALLGEAVVLLNPIFKEEFPYHIKQRGALMAK
GRLLGIQFETLFQNELWLELAKHANSLAEEIADCCESLGFKFLTLPQSNQIFPILPANVR
SELHKKYDFFDWQPIDDDRCAIRVVTSWATSKADVTSFIQDLCTLQKK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgggagttttttttatgataaaatttctgaacgattacagcgaaggggcacatccccta
atcctgcaaagactggctgaaactaacttagatcagcagtcgggctatggcactgatagc
tatagtgaagcagcaaggcaatatatacggtctgcaatgaagaggccggatgctgacgtt
tatttcgtttccggaggaactcaggcaaacctgttggtaattgctgcccttctcaagcct
tttgagtccgtaattgctgttgagtccgggcatatcaatacacatgaaacgggggctata
gaggccacaggtcataaaattgagtatgtacttggaaaagaggggaaacttactccggag
ctcattgcgccggtactagtgaagtctccaaaataccataccgttaaaccaaggatggta
tatatatcaaatactaccgaacttggaacggtgtatagcaaggcggaacttcaagcttta
tcggaatattgtaaagcgaatgacctattgcttttcatggatggtgcccgactagccatg
gcacttgcttctaagttcaatgatcttactttagaagatattgcttcttactgcgatgtc
ttttacataggaggtactaaaaatggtgctttattaggtgaagcagtagtattattgaat
cccatttttaaggaggaatttccttaccatatcaagcaaagaggtgctctaatggcaaaa
ggaagattgttaggaatacagttcgaaactttatttcaaaatgaactttggctagaacta
gcaaagcacgctaattcattagcagaggaaattgcggattgctgcgaatctttaggattt
aagtttctgactcttcctcaatccaatcagatatttcctatattgcctgcaaatgttcgt
tcagaacttcataagaagtacgacttctttgattggcaacctatagatgatgataggtgt
gccatcagggttgtaacttcttgggctacgagcaaagctgatgtcacctcatttatacaa
gatttatgtactctgcagaaaaagtaa

DBGET integrated database retrieval system