KEGG   Leadbetterella byssophila: Lbys_2938Help
Entry
Lbys_2938         CDS       T01350                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lby  Leadbetterella byssophila
Pathway
lby00010  Glycolysis / Gluconeogenesis
lby00052  Galactose metabolism
lby00500  Starch and sucrose metabolism
lby00520  Amino sugar and nucleotide sugar metabolism
lby00521  Streptomycin biosynthesis
lby01100  Metabolic pathways
lby01110  Biosynthesis of secondary metabolites
lby01120  Microbial metabolism in diverse environments
lby01130  Biosynthesis of antibiotics
lby01200  Carbon metabolism
Module
lby_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbys_2938
   00052 Galactose metabolism
    Lbys_2938
   00500 Starch and sucrose metabolism
    Lbys_2938
   00520 Amino sugar and nucleotide sugar metabolism
    Lbys_2938
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Lbys_2938
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Lbys_2938
Enzymes [BR:lby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Lbys_2938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADQ18600
UniProt: E4RT62
Position
3301996..3302904
Genome map
AA seq 302 aa AA seqDB search
MATEYLGIDIGGTNVKMGIVDATNGNIKNFYSHETSSWRASGHFVERLGDAIVLQLKENP
DVKKVGIGVPGLISRDRNTLIEITAIPETNGIHIIPVLKERFPDHEFFLENDANAAALGE
YYFGEEKLPEDYIFVTLGTGVGGAAIIDKQVFKGGGGNAMEPGHMPSENGKVLERIIGKN
ELLDMANEMRAAFEGETKLPADGTISTTGLVAAASEGDELALQIFDRVGGLLGDGLVSMI
RILDITTVLIGGGLSASFDYILPAIQRQLKYWLTPYYVKTLDIRRATLANDAGLLGAASL
CF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggaatacctggggatagacattggcggaacaaacgtgaaaatgggcatagta
gacgccaccaacggtaatattaagaatttttatagtcacgaaaccagttcatggcgtgct
tccgggcactttgtagagcgattaggagatgctatagttctgcagctaaaggaaaatcct
gatgttaagaaagtggggatcggtgttcctggtttaatttcaagagatcgaaataccttg
attgaaattaccgctattcctgagaccaatggtattcatattattcctgttttaaaggag
agatttccagatcatgaattcttcctggaaaatgatgcaaatgctgcagctttaggtgaa
tattattttggagaagagaaactaccggaagattatatttttgtgaccttaggcacaggg
gtaggcggtgcagccattattgataagcaagtattcaaaggaggtggcggaaacgctatg
gagccgggtcatatgccttctgagaacggaaaagttttggaaaggatcattggcaagaat
gagcttttagatatggctaatgagatgcgtgcagcatttgaaggtgaaacaaaacttcct
gctgacggtaccatttctaccacgggattagtggcagctgcttcggaaggagacgagctt
gctttacagatctttgaccgggtaggtggtctgcttggtgatggtctagtgagcatgata
cgtatattagatattactacggtacttattggaggcggtttgtcagcttcctttgattat
atattacccgctattcagcgtcaattgaagtattggttaactccttattacgtaaaaact
ttagatattcggagagctacattagcaaatgacgcgggacttttaggcgcggctagctta
tgcttctaa

DBGET integrated database retrieval system