KEGG   Leadbetterella byssophila: Lbys_3113Help
Entry
Lbys_3113         CDS       T01350                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lby  Leadbetterella byssophila
Pathway
lby00020  Citrate cycle (TCA cycle)
lby00480  Glutathione metabolism
lby01100  Metabolic pathways
lby01110  Biosynthesis of secondary metabolites
lby01120  Microbial metabolism in diverse environments
lby01130  Biosynthesis of antibiotics
lby01200  Carbon metabolism
lby01210  2-Oxocarboxylic acid metabolism
lby01230  Biosynthesis of amino acids
Module
lby_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lby_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lbys_3113
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Lbys_3113
Enzymes [BR:lby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Lbys_3113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF4115 Nucleolin_bd
Motif
Other DBs
NCBI-ProteinID: ADQ18774
UniProt: E4RUN8
Position
3509351..3511609
Genome map
AA seq 752 aa AA seqDB search
MFNFVDIGRQILNKMSKIIYTITDEAPALATYSFLPIVEAFTKPAGVEIETRDISLSGRI
LANFSEFLTDEQKVSDDLAYLGKLAVEPEANIIKLPNISASIPQLVAAIKELQAKGYAVP
DYPEEPKTGEETFIKAKYDKIKGSAVNPVLREGNSDRRAPKAVKEYARKHPHSMGAWSAD
SKSHVSSMTEGDFYGSEKSVVVPKATKYKITFVGADGSTKVLKEGASLQEGETVDSAVMS
YSKLNDFYAKEIEDAKAKDVLFSVHLKATMMKVSDPILFGGAVYQYFKEVYDKYATLFDE
LNINPNNGLGDLEKKIASLPEDQKAAIEADIKAVYEKNPALAMVNSDKGITNLHVPSDVI
IDASMPAAIRTSGQMWGPDGKQKDTKFVIPDRCYSGVYQTVIDFCKNNGALDPVTMGSVS
NVGLMAQAAEEYGSHDKTFQLAGAGTVQVTDEDGNVLMEQAVEAGDIFRMCQTKDAPVQD
WVKLAVNRARATNTPAIFWLDKNRAHDANLIQKVEKYLKDHDTTGLDIQIMSPAEATQYS
LERIVKGLDTISVTGNVLRDYNTDLFPILEVGTSAKMLSIVPLMNGGGLFETGAGGSAPK
HVQQFVEEGYLRWDSLGEFLALAVSLEHFAQVNNNPKAQVLADTLDEATGKFLENDKSPA
RKVGQIDNRGSHFYLALYWAQALAAQDKDAELKAIFAPIAEELTAKEAAINEELLGAQGK
PQDIGGYYKPEFAKASAAMRPSTTFNSILAKL
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgtttaactttgtggatattggacgccaaattttaaataaaatgtcaaaaataatttat
accattacggacgaagcacccgctttggctacgtattcttttttacccatagtagaagct
tttaccaaaccggcaggagttgaaattgaaacccgtgatatttccctttcaggtcgtatt
ctggctaacttttcagagttcttaacagatgagcagaaggtctctgatgatttggcatat
ttagggaagttagcagttgagccggaagcgaacatcattaaacttcctaatatttcggca
tccattcctcaattagtagcggcgatcaaagaacttcaagctaaaggatatgcggttcct
gattaccctgaagaaccaaaaacgggagaagaaacctttatcaaagcgaaatacgacaag
atcaaaggttccgcagttaaccctgtattaagagaaggaaactctgaccgtagagcaccg
aaagcggtgaaagaatatgctagaaaacatccgcatagcatgggagcttggagtgcagat
tctaagtcgcacgtttcttccatgacagaaggtgatttctatggtagtgaaaaatctgta
gttgttcctaaagctactaagtataaaataaccttcgtaggagcagatggaagtactaag
gttctaaaagaaggtgcttctttacaagaaggagaaactgttgattctgctgtaatgtcc
tatagcaagttgaatgatttctacgccaaagagattgaagacgcaaaagcaaaggatgta
cttttctccgtacacttgaaagctaccatgatgaaggtttctgaccctattttatttggt
ggagctgtgtatcaatatttcaaagaagtgtatgataagtatgccactttatttgatgag
ttaaatatcaatccaaataatggtctaggtgatcttgagaagaaaatcgcaagccttcct
gaagatcaaaaggctgctattgaggctgatattaaggcagtgtacgaaaagaatcctgca
ttggcaatggtgaactctgacaagggaatcactaatcttcacgtacctagtgacgttatc
attgatgcatctatgcctgccgctatccgtacctccggacaaatgtgggggcctgacgga
aaacaaaaggatacaaaatttgttattcctgatcgttgttactctggtgtttatcaaacg
gtaattgatttttgtaaaaataatggtgctctagatcctgttactatgggttctgtatca
aacgtaggtttgatggctcaggcagcagaagaatatggttctcatgacaagactttccaa
ttagcaggtgcaggtactgttcaggttacagatgaggacggtaatgtgttaatggagcaa
gcggtagaagctggtgatatcttccgtatgtgtcaaacgaaagatgcaccggttcaggat
tgggtaaaacttgcagtaaatcgggcaagagctactaacactccagccatcttttggtta
gataagaatcgtgcacatgatgcaaatctgatccaaaaagtagagaagtatttgaaagac
catgacactacaggtttggatatccaaatcatgagccctgctgaagctacccaatactct
ttagaaaggatcgtaaaaggattagataccatttccgtaaccggaaacgtacttagagat
tacaatactgacttgttcccgatcttagaggtaggtacttccgctaaaatgctgtctatc
gtgccattgatgaacggtggtggattatttgagacaggtgcaggtggatctgctcctaaa
cacgtacagcaattcgtagaagaagggtatttaagatgggactccctaggagagtttcta
gctttagccgtttcccttgagcatttcgcacaggtaaataataatcctaaagctcaagtt
cttgcagatactctagatgaagctaccggtaagttccttgaaaatgacaagtcacctgca
agaaaagtaggacagattgataacagaggtagccacttctatttagcactatactgggct
caagcccttgctgcacaggataaagatgcagaattgaaagctatctttgctccaattgca
gaagagttgacagctaaagaagctgccatcaatgaagaattactaggggcacaaggtaaa
cctcaagacataggagggtattataaacctgagttcgctaaagcttcagcagccatgcga
ccaagcaccactttcaacagcattcttgctaagttgtaa

DBGET integrated database retrieval system