KEGG   Leadbetterella byssophila: Lbys_3517Help
Entry
Lbys_3517         CDS       T01350                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lby  Leadbetterella byssophila
Pathway
lby00500  Starch and sucrose metabolism
lby01100  Metabolic pathways
lby01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Lbys_3517
Enzymes [BR:lby01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Lbys_3517
Exosome [BR:lby04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lbys_3517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Malt_amylase_C Glyco_hydro_70 DUF3459
Motif
Other DBs
NCBI-ProteinID: ADQ19165
UniProt: E4RZ47
Position
3964480..3966405
Genome map
AA seq 641 aa AA seqDB search
MAKKKEPAVEFKNVEAYSLFTDFDISLFKSGKHYRLYEKFGTHVLEHQGVVGTYFAVWAP
NARSVHVIGNFNAWNHESHGLYPRWDGSGIWEGWIPNIGNGEIFKYRIVSNHHGVITEKG
DPYALTWEEAPRTSSIVWDTWYEWKDKDWMSKRREKNHLDAPVSVYEVHLGSWRRDPSDP
ERRLNYREIADALVPYVKDLGFTHVEFMPVMQHPYEPSWGYQITGYFAVNSKQGSPQDFM
YLVEQLHQNGIGVILDWVPSHFPGDAHGLYRFDGTALYEHEDPRQGYHPDWKSYIFNYAR
YEVRSFLISNALFWLDRFHIDGLRVDAVASMLYRDYSRQDGQWVPNVFGGRENLEVISLL
KELNEEVYKSFPDVQTIAEESTAFPGVSRPVYTGGLGFGMKWMMGWMNDALRYFARDPMY
RKWHQNDLTFSLVYAFSENFMLPLSHDEVVYGKGSLLMKMPGDTWQKFANLRLLFSYMFL
HPGTKLLFMGGEFGQVKEWNFLQSLDWHLLEEYSHKGLQLALTDLNHLYRSTLVLHKGQF
TSECFQWVDGSDTENCVISFLRKADDQAVLVVLNLTAQPQRDYRIGFPNQKEVVELFNSD
HTKYGGSGVGNEKIYIEEVPYQGFPYSVRLSLPPLGALVIG
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaagaaggaacctgcggtggaatttaagaacgtagaagcttattccctcttt
acggattttgacatcagtttatttaaatccggaaagcattaccgtctttatgagaagttt
ggaacacatgttctggaacatcaaggtgtggtgggtacttacttcgccgtatgggctccg
aatgcccgttctgttcatgtcattggaaattttaacgcctggaatcatgagtcccacggc
ttgtaccctcgctgggatggatctggaatctgggaaggatggataccgaatataggaaac
ggtgagatctttaaatacagaattgtttccaatcatcacggagtcattacggaaaagggt
gacccatatgctttaacatgggaggaagctccccgcacttcttccatagtatgggatacc
tggtatgaatggaaggataaagactggatgagtaaacgcagggagaaaaaccatttggac
gcccctgtttctgtatatgaggtgcatttgggttcatggagaagagatcccagtgatcca
gaaagaagattgaattacagggagattgctgatgctttggttccttatgttaaggactta
ggttttacccatgtagaattcatgccggtcatgcagcacccttatgagccttcttggggg
tatcagattactggttattttgcggtgaattcaaagcaaggttctcctcaagattttatg
tatctggtggagcaattgcaccaaaacggcataggagtgatcctggactgggtaccttct
cacttcccgggagatgctcatggtttatatagatttgacggcacagctctatatgaacac
gaggatccccgtcagggctaccacccggattggaagtcatatatctttaattatgctaga
tatgaggtgagatctttcctcatcagtaatgcactattctggttagaccgctttcacata
gatggtttgagagtggatgcggtagcatctatgctgtatagagattactcccgccaggat
ggacaatgggtacctaatgttttcggaggtagggaaaatctagaagtcatttcattatta
aaagaattaaacgaggaagtctacaaatccttccctgacgttcaaaccatagcggaagag
tctaccgcctttccaggggtttcccgacccgtttatactggaggtttaggattcggtatg
aaatggatgatggggtggatgaatgatgctctgaggtatttcgcccgtgatcctatgtat
agaaaatggcatcagaatgacctgacctttagcttggtttatgccttttcagagaacttt
atgctccccctttcacacgatgaagtggtttatggtaaaggttctcttttgatgaaaatg
cccggagatacatggcagaagtttgctaaccttagattacttttctcttatatgttcttg
catcccggaacgaaactgctctttatgggaggggagtttggacaagttaaagaatggaat
ttcttgcagagcctggattggcatttactagaggagtattcacataaggggctgcaactg
gcattaacagacctgaatcatctttatcgttctacgcttgttttacataagggacaattt
acttccgaatgttttcagtgggtggatggctcagataccgaaaactgcgttatcagcttt
ctcagaaaagcggatgaccaggcagtattggtagtcctaaaccttacggcccagcctcag
agagattatagaataggatttcctaaccagaaagaagtagtggagctcttcaattctgat
cataccaaatatggaggttcaggagtagggaatgaaaagatttatattgaagaggttcct
tatcaagggtttccttactctgtccgactttcacttcctccacttggggcacttgtgata
ggttga

DBGET integrated database retrieval system