KEGG   Leishmania braziliensis: LBRM_06_0010Help
Entry
LBRM_06_0010      CDS       T01113                                 

Definition
(RefSeq) putative ABC transporter
Organism
lbz  Leishmania braziliensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane ABC_tran AAA_21 SMC_N AAA_16 RsgA_GTPase NACHT AAA_23 AAA_29 ABC2_membrane_3 DUF87 AAA_24 AAA_22 MMR_HSR1 PRK Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 4961247
NCBI-ProteinID: XP_001561938
UniProt: A4H4G9
Position
6:complement(2587..4563)
Genome map
AA seq 658 aa AA seqDB search
MPLLNSELMDERNSINVADPDFTAKSERQTPSSLNINLEMPPSTANLDSGTLKTGSVPDS
YSLPLSWSKLSYSAGKKRILCGLTGTALPGRCLAILGSSGAGKTTFLNAISDRLASGGAL
RLSGRRQLGDCELERHFRKAMGFVTQDDIISPLSTPYDALWFSLRTRRGTGRAETEERVQ
EALDVLRLQHCRNTKVGIPGLEAGLSGGERKRCSIGIELICDPKVLLLDEPTSGLDSVTS
AKVVHLLRQLSRMGRTVIYTIHQPTAEVLSYFDDVMLMTQGRIAYHGTMAASLDYFESIG
FVCPSKYTPTDYYMVLLQDSATSKILIKRWSKYLKNGPRTPHSAAVRLAKSRRESSAARF
LDAYIVKFGSSPVVQFYELTRRTLIEISRDSLYLFSYMAQAVFFAVVVGLIFLNLRSNVE
GIQDRQGLLFMIVMNRAMSSTFIMINTFNNVRAVYTREQQAGAYSPLMFFLGRSVAEFPV
QILAVLVESCILYWMVGLHRAPGSFFYYCGVVALLSQVATGLGFAISTACPSLMIGSAIT
PPILIPLALGGGLFASTDRLRPYWYWIEKPSFMRHTYILLMRNELYNVHNITCDNYRWGD
EYCINQPRDGRTVLRLLQFDGDPQSESVYMWLSLVVLFFLLRIICVISLTIASRARTG
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcttaaacagcgaactcatggatgaaaggaactccatcaatgtggcggaccca
gactttaccgccaaaagcgagcgccagaccccttcctctctcaatatcaacctcgagatg
ccaccttccaccgccaacctggactccggcacgctgaagacaggcagcgtgccggacagc
tactcgctgccgctgtcgtggagcaagctgagctacagcgccggcaagaagcgcatcctg
tgcgggctgacggggactgcgctgcccgggcggtgcctcgcgatcctcgggtcgtccggt
gccggcaagacgacgttcctgaacgcgatcagcgaccgacttgcgtctggcggcgccctg
aggctgagcgggcggcgccagctgggcgattgcgagctcgagcggcactttcgcaaggcg
atggggtttgtgacccaggacgacatcatctcgccgctgtcgacgccgtacgacgcgctg
tggttctcgctgcgcacgcggcgcgggacgggccgtgcggagacggaggagcgtgtgcag
gaggcgctggatgtactgcggctgcagcactgccgcaacacgaaggttggcatccccgga
ctggaggctgggctgtctggtggcgagcgcaagcggtgcagcatcgggatcgagctgatc
tgcgacccgaaggtgctgctgcttgatgagccgacgtctgggctagactccgtgacgtct
gcgaaggtcgtacacctgctgcgccagctgtcgcgtatgggccgcactgtgatctacacg
atccatcagccgactgcggaggtgctgtcgtacttcgacgacgtgatgctgatgacgcag
ggccgcattgcgtaccacgggacgatggcggcgtcgctggactacttcgagtctatcggg
ttcgtgtgcccgagcaagtacacgccgacggactactacatggtgctgctgcaggacagt
gcgacgagcaagatcttgatcaagcgttggagcaagtacctgaagaacggcccccgcaca
ccgcacagcgccgcggtgcgtcttgcgaagagccgccgcgagtcgtcagctgcgcggttc
ctggatgcgtacattgtgaagttcggcagctcgccggttgtgcagttctacgagctgacg
cggcgcacgctgatcgagatctcccgtgattcgctctacctcttctcgtacatggcgcag
gcggtcttctttgccgtggtcgtgggcctgatcttcttgaatctgcgctccaacgtggag
ggcattcaggatcgccagggcctgctgttcatgatcgtgatgaaccgtgcgatgagctcg
acgttcatcatgattaacacgttcaacaatgtgcgcgccgtgtacacgcgtgagcagcag
gccggcgcgtactcgccgctgatgtttttccttgggcggagtgtcgctgagtttcccgtg
cagattcttgcagtgctggtggagagctgcatcctgtactggatggtgggcctgcatcgt
gcgcctgggtcgttcttctactactgcggtgtggtggcgctgctgtcgcaggtggcaact
ggactgggttttgccatctccaccgcgtgcccgtcgctgatgattggttctgccatcaca
ccgccgatcttgatcccactggctctaggcggcggcctgttcgcgagtacggaccgtctg
cggccgtactggtactggattgagaagccgtcgttcatgcgccacacgtacattctcttg
atgcgcaatgagctgtacaatgtgcacaacatcacgtgcgacaactaccgctggggagac
gagtactgcatcaaccagccgcgtgatggacgtacagtgctgcgtctgcttcagtttgac
ggtgacccgcagtctgagagtgtgtatatgtggctgtccttggttgttctgttcttcctg
ttacgcatcatttgtgtgatttcgctcacaatcgcgagccgtgccaggactggatga

DBGET integrated database retrieval system