KEGG   Leishmania braziliensis: LBRM_09_0740Help
Entry
LBRM_09_0740      CDS       T01113                                 

Definition
(RefSeq) conserved hypothetical protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
lbz  Leishmania braziliensis
Brite
KEGG Orthology (KO) [BR:lbz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lbz03016]
    LBRM_09_0740
Enzymes [BR:lbz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     LBRM_09_0740
Transfer RNA biogenesis [BR:lbz03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    LBRM_09_0740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-GeneID: 5413166
NCBI-ProteinID: XP_001562688
UniProt: A4H5P7
Position
9:272718..273695
Genome map
AA seq 325 aa AA seqDB search
MKPARKKPSRTGEPKPRPFPQPDDVSAQQQKQRDKEFATHKTHILANLQTNACDLSPKGS
VDVKCTPVMNLLNTHRDYVTTSSCSGRIALFHNITHSEVCRTDKKTATPKPRMKRGDKAA
LGWVFVKHGMLHPIEMAQVVRFLCGAATTPEDVALDAAQMEKHAAHVASVSGGANSHGTT
SSSPPAGMYDGEVEGVLVEAQASGDEAAPLPVPTRGTVSIKMEPFVMHVECRTMEAAKLL
LSAAVSDSGYRNSGVVPPGKKIMCGIRSTAGLGLEVPVVLHGVNHVASQRGYVWALLGLA
NEKMEANDKKIRLLEKFVAARVLPA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggcgcgcaagaagccatcgaggacgggagaacccaagccccgaccgtttcct
cagcccgacgacgtctccgcacaacagcagaagcaacgagacaaggagtttgccacgcac
aagacacacattctagccaacctgcagacgaacgcttgtgacctgagccctaagggcagc
gtagatgtgaagtgcacccctgtgatgaacctgctcaacacgcacagggactacgtcacg
acaagcagctgcagcgggcgcatcgccctctttcacaacatcacgcacagcgaagtgtgc
aggaccgacaagaagacggcaacgccgaaaccgcgcatgaagcggggcgacaaggcggcg
ctcggctgggtgttcgtgaagcacggcatgctgcacccgatagagatggctcaggtggtc
cgcttcctctgcggggcagccaccacgccggaggatgtagccctggatgcggcacagatg
gagaagcacgcggcccacgtcgcctctgtgagcggcggcgccaacagccacggcaccacc
tctagctctccgcctgctggtatgtatgatggcgaggtggagggagtgctggtggaggcg
caagcaagcggagatgaggctgcgccgctgcccgttcctacacgcggcaccgtgtcgatc
aaaatggagccgtttgtcatgcacgttgagtgccgcacgatggaggctgcgaagctgctg
ctttcggcagcggtgagcgacagcggttaccgcaacagtggcgttgtcccgcctggcaag
aagattatgtgcggcatacgcagcaccgctgggctggggctggaggtgcctgtcgtcctt
cacggggtcaaccacgtggcgtctcagcggggatacgtttgggcgctgctgggactcgcg
aatgaaaagatggaagcgaacgataaaaagataagactgctggagaagttcgtggcggcg
cgcgtcttaccggcctga

DBGET integrated database retrieval system